DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and agfg2

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_001025409.1 Gene:agfg2 / 569643 ZFINID:ZDB-GENE-050913-119 Length:246 Species:Danio rerio


Alignment Length:242 Identity:50/242 - (20%)
Similarity:88/242 - (36%) Gaps:72/242 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   665 ANSEERDEWVAAVEQEIFKSLQSIESSKTKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWAS 729
            :|.:.||.             |.|.:.|.::...|.:            |..|.:|..|...:..
Zfish     2 SNRKHRDN-------------QEICARKVRELAQTGV------------NKHCFECNQPGVTYID 41

  Fly   730 LNLGVLMCIECSGVHRNLG-SHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVW----------- 782
            :.:|..:|..|||:.|.|. .|  :|:|:.:..:....:..:...|:.:....|           
Zfish    42 ITVGCFVCTSCSGMLRGLNPPH--RVKSISMTTFSQQEVEFLQNHGSEVGRRTWLCTFDPKTDGC 104

  Fly   783 -ESNTRQRVKPTSQASREDKERWVRSKYE-AKEFLTPLGNGSSAHPSP-SPGQQLIEAVIRADIK 844
             ::...|::|...| .:.::::|..||.: .::..||.|.|..|.|:| .|.|            
Zfish   105 FDARDTQKLKEFLQ-DKYERKKWHFSKSKMRRDTDTPWGPGVQAIPAPHGPAQ------------ 156

  Fly   845 SIVSILANCPSEVTNANVSARDVRTPLLLACAIGNLAIAQLLIWNGA 891
                   |.|......|.:.|..||          |:.:||.||:.|
Zfish   157 -------NQPPPGHPLNPTNRPTRT----------LSQSQLSIWDRA 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 3/20 (15%)
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 23/129 (18%)
ANK <834..907 CDD:238125 12/58 (21%)
ANK repeat 834..866 CDD:293786 3/31 (10%)
Ank_5 859..907 CDD:290568 10/33 (30%)
ANK repeat 868..897 CDD:293786 8/24 (33%)
agfg2NP_001025409.1 ArfGap 14..126 CDD:279720 21/126 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.