DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and git2b

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_005155464.1 Gene:git2b / 567190 ZFINID:ZDB-GENE-070112-2192 Length:738 Species:Danio rerio


Alignment Length:230 Identity:75/230 - (32%)
Similarity:111/230 - (48%) Gaps:34/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   705 LAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSV 769
            ::||.|  ....|.||.||:..|||:|.|||:|.||..:||.||.|.|:||.|....|||..|.:
Zfish     1 MSIRAR--NREICADCSAPDSRWASINRGVLICDECCSIHRGLGRHSSQVRHLTQTSWPSSQLQM 63

  Fly   770 MLAIGNSLANSVWE---------------SNTRQRVKPTSQASREDKERWVRSKYEAKEFL--TP 817
            :.::.|:.|||:||               :|.:.||.|       :|..::::||:...|:  .|
Zfish    64 VKSLYNNGANSIWEHSLLDPSSIMSGKRKANPQDRVHP-------NKTDFIKAKYQMLAFVHRMP 121

  Fly   818 LGNGSSAHPSPSPGQQLIEAVIRADIKSIVSILANCPSEVTNAN-VSARDVRTPLLLACAIGNLA 881
            .....|. .:....:||..:|...::::.:.:|    |....|| .......|||.:|...|.|.
Zfish   122 CREDDSV-TAKDLSKQLHSSVRTGNLETCLRLL----SLGAQANFFHPEKGNTPLHVAAKAGQLL 181

  Fly   882 IAQLLIWNGANIKHTDHEGRTCLAYARAA--QSLA 914
            .|:||...||:....|..|:|.:.|||.|  |.||
Zfish   182 QAELLTVYGADPGAPDSSGKTPIDYARQAGHQDLA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 45/129 (35%)
ANK <834..907 CDD:238125 20/73 (27%)
ANK repeat 834..866 CDD:293786 6/32 (19%)
Ank_5 859..907 CDD:290568 16/48 (33%)
ANK repeat 868..897 CDD:293786 11/28 (39%)
git2bXP_005155464.1 ANK <123..220 CDD:238125 29/99 (29%)
Ank_2 137..229 CDD:289560 27/84 (32%)
ANK repeat 137..165 CDD:293786 6/31 (19%)
ANK repeat 167..197 CDD:293786 11/29 (38%)
GIT_SHD 268..296 CDD:285690
GIT_SHD 332..359 CDD:285690
GIT_CC 427..481 CDD:293167
GIT1_C 628..732 CDD:289013
ArfGap 5..124 CDD:214518 44/127 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.