DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and ASAP3

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_011540057.1 Gene:ASAP3 / 55616 HGNCID:14987 Length:926 Species:Homo sapiens


Alignment Length:717 Identity:151/717 - (21%)
Similarity:247/717 - (34%) Gaps:226/717 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 SSKSLNKEWKKKYVTLCDDGRLTYHPSLHDY---MDDVHGKEIPLQYVTVKVPG----------- 514
            |.|.|.|.||                   ||   |..:. ||.....||..:||           
Human   143 SKKQLEKAWK-------------------DYEAKMAKLE-KERDRARVTGGIPGEVAQDMQRERR 187

  Fly   515 -------------------QKPRGSKSIITNSALTSSLMANGQRAQNTLSDGIGCLTLA------ 554
                               |.|...:|:|.......:...:|.:|..:|...|..|..:      
Human   188 IFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLFPFIEKLAASVHALHQ 252

  Fly   555 --KDNQRKLSE-KLSLLGAGSIAAGAGGEPLKSNSSQQTSGDEGIAMSNSNSQTFIAGEVANAGN 616
              :|..:||:: :.||.|...:.:..|.|.|    |::.||.......:..::.|...:|.....
Human   253 AQEDELQKLTQLRDSLRGTLQLESREGQEHL----SRKNSGCGYSIHQHQGNKQFGTEKVGFLYK 313

  Fly   617 KLEAQTPNVKKRHRRMKSSSVKANEADDN-----------------DGYEFYIVSLDSKQWHFEA 664
            |.:......:||...:|...:..:.:..|                 :..:.:.:...::.:||:|
Human   314 KSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNPEEKKCFDLVTHNRTYHFQA 378

  Fly   665 ANSEERDEWVAAVEQEIFKSLQSIESSKTKQATST-----------DLAAML--AIRQRVPGNGF 716
            .:..|.:.||:.::....::|.|....:......:           ||..:|  .::.| |||..
Human   379 EDEHECEAWVSVLQNSKDEALSSAFLGEPSAGPGSWGSAGHDGEPHDLTKLLIAEVKSR-PGNSQ 442

  Fly   717 CVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSV 781
            |.||||.:|.|.|.|||||.||:||||||.||...|:::||.||......|.:.|.:||:..|.|
Human   443 CCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEV 507

  Fly   782 WESN--TRQRVKPTSQASREDKERWVRSKYEAKEFLTPLGNGSSAHPSPSPGQQLIEAVIRADIK 844
            .|:.  :....||::::....:..::.:||....|        :...:|.| |:|..|:...|:.
Human   508 MEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRF--------ARRCTPEP-QRLWTAICNRDLL 563

  Fly   845 SIVSILANCPSEVTNANVSARDVRTP----LLLACAIGN---LAIAQLLIWNGANIKHTDHEGRT 902
            |::...||  .:.....:...|.:.|    |.||..:.|   |.:...:|.||.::.....:|.|
Human   564 SVLEAFAN--GQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNT 626

  Fly   903 CLAYA--------------------------RAAQSLATAKSIKAA----AAAQAGTTI------ 931
            .|.||                          ..|..:|..|..|..    ..|||||..      
Human   627 ALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLHVD 691

  Fly   932 ----------------------PAPAPPTNG--------------GIPAPQY----NVEDTTALV 956
                                  |:|.|..:|              .:||..:    .::.:....
Human   692 YSWVISTEPGSDSEEDEEEKVGPSPVPQASGWQKERARLGLRCLLKLPAQAHWASGRLDISNKTY 756

  Fly   957 ELLEGLG----------CPEAAPL-TASGTL----------------------PRRRDTLGTPYE 988
            |.:..||          ||...|: .:|.||                      |...::||:|..
Human   757 ETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCARHASGDRSEVSSLSSEAPETPESLGSPAS 821

  Fly   989 KS 990
            .|
Human   822 SS 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 49/280 (18%)
PH 454..>521 CDD:278594 17/89 (19%)
ArfGap 702..818 CDD:279720 45/119 (38%)
ANK <834..907 CDD:238125 19/79 (24%)
ANK repeat 834..866 CDD:293786 6/31 (19%)
Ank_5 859..907 CDD:290568 13/54 (24%)
ANK repeat 868..897 CDD:293786 9/35 (26%)
ASAP3XP_011540057.1 BAR_ASAP3 35..243 CDD:153324 23/119 (19%)
PH_ASAP 296..402 CDD:270071 14/105 (13%)
PH 309..392 CDD:278594 11/82 (13%)
ArfGap 430..545 CDD:279720 45/123 (37%)
ANK repeat 553..586 CDD:293786 7/34 (21%)
ANK repeat 588..621 CDD:293786 8/32 (25%)
ANK <592..676 CDD:238125 17/83 (20%)
Ank_5 610..664 CDD:290568 9/53 (17%)
ANK repeat 623..654 CDD:293786 5/30 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.