DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and APPL2

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_001238833.1 Gene:APPL2 / 55198 HGNCID:18242 Length:670 Species:Homo sapiens


Alignment Length:270 Identity:49/270 - (18%)
Similarity:91/270 - (33%) Gaps:86/270 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   632 MKSSSVKANEADDNDGYEFYIVSLDSKQW-HFEAANSEERDEWVAAVEQEIFKSLQSIESSKTKQ 695
            :.:.||.|.:.:|. .|.|.|.:.:.|.. ..:|.:.:|.:||:.|:            ::.::|
Human   331 LDNCSVMAVDCEDR-RYCFQITTPNGKSGIILQAESRKENEEWICAI------------NNISRQ 382

  Fly   696 ATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGL- 759
            ...||                       |||..::.|           ::.....::.:.|.|. 
Human   383 IYLTD-----------------------NPEAVAIKL-----------NQTALQAVTPITSFGKK 413

  Fly   760 --DDWPSPHLSVMLAIGNSLANSVWESNTRQRVKPTSQASREDKERWVRS----KYE----AKEF 814
              ...||          .:|.||..| |...::.|.:.||..:.|..:..    :::    |.||
Human   414 QESSCPS----------QNLKNSEME-NENDKIVPKATASLPEAEELIAPGTPIQFDIVLPATEF 467

  Fly   815 L---------TPLGNGSSAHPSPSPGQQLIEAVIRADIKSIVSILANCPSEVTNANVSARDVRTP 870
            |         .|.|. :.....|.....|::.:.      ||..|.:...:..:......:....
Human   468 LDQNRGSRRTNPFGE-TEDESFPEAEDSLLQQMF------IVRFLGSMAVKTDSTTEVIYEAMRQ 525

  Fly   871 LLLACAIGNL 880
            :|.|.||.|:
Human   526 VLAARAIHNI 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 13/54 (24%)
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 21/135 (16%)
ANK <834..907 CDD:238125 9/47 (19%)
ANK repeat 834..866 CDD:293786 4/31 (13%)
Ank_5 859..907 CDD:290568 5/22 (23%)
ANK repeat 868..897 CDD:293786 5/13 (38%)
APPL2NP_001238833.1 BAR_APPL2 20..240 CDD:153316
BAR-PH_APPL 258..382 CDD:270067 13/63 (21%)
PTB_APPL 488..621 CDD:269980 10/54 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 649..670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.