DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and abce1

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_001005628.1 Gene:abce1 / 448085 XenbaseID:XB-GENE-993988 Length:599 Species:Xenopus tropicalis


Alignment Length:168 Identity:36/168 - (21%)
Similarity:58/168 - (34%) Gaps:47/168 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LGIVGSLNSGKSALVHRYLTGSYMQEESPEGGRFKKEVFIDGQSYLLLIRDEGGAPEMQFAGWVD 209
            ||:||:...|||..: :.|.|    ::.|..|  |.:...|.|..|...|    ..|:|      
 Frog   106 LGLVGTNGIGKSTAL-KILAG----KQKPNLG--KHDDPPDWQEILTYFR----GSELQ------ 153

  Fly   210 AVIFVFSLENEGSFNTVYNYYTKMAHF--------RNGQEIPMILVGTQDAISERNPRVIDDTRA 266
                              ||:||:...        :...:||....|....|.:|.    |:|:.
 Frog   154 ------------------NYFTKILEDDLKAIIKPQYVDQIPKAAKGPVGTILDRK----DETKT 196

  Fly   267 RKLASDLKRCSYYETCATYGLNVERVFQDACQKILSQR 304
            :|...|....::........|:...:.:.||..:..||
 Frog   197 QKSVCDQLDLTHLRDRNVEDLSGGELQRFACAVVCIQR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303 34/162 (21%)
RAS 144..295 CDD:214541 32/157 (20%)
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720
ANK <834..907 CDD:238125
ANK repeat 834..866 CDD:293786
Ank_5 859..907 CDD:290568
ANK repeat 868..897 CDD:293786
abce1NP_001005628.1 Rli1 4..597 CDD:224166 36/168 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.