DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and ArfGAP3

DIOPT Version :10

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster


Alignment Length:168 Identity:54/168 - (32%)
Similarity:79/168 - (47%) Gaps:20/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   712 PGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLD-DWPSPHLSVMLAIGN 775
            |.|..|.||.|..|.|:|:..|:.:||:||.||||||.|::.|||..|| :|....|..|...||
  Fly    24 PANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQLGGN 88

  Fly   776 SLANSVWE----SNTRQRVKPTSQASREDKERWVRSKYEAKEFLTPLGNGSSAHPSPSPGQQLIE 836
            :.|...:.    |.|..:||..|:|::..:::......:|.:     .:|:..|...:...:..|
  Fly    89 ANAAQFFRAHNCSTTDAQVKYNSRAAQLYRDKLCAQAQQAMK-----THGTKLHLEQTDKSEGNE 148

  Fly   837 AVIRADIKSIVSILANCPSE----VTNANVSARDVRTP 870
            |....|      ..|.|.:|    |.|.|||.:|...|
  Fly   149 AAREED------FFAQCDNEVDFNVQNNNVSKQDPNPP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <2..41 CDD:461363
Centaurin_gamma 143..300 CDD:133303
PH_AGAP 451..686 CDD:241281
ArfGap_AGAP 702..810 CDD:350065 38/102 (37%)
ANKYR <834..>907 CDD:440430 13/41 (32%)
ANK repeat 834..866 CDD:293786 11/35 (31%)
ANK repeat 868..897 CDD:293786 1/3 (33%)
ArfGAP3NP_001097664.2 ArfGap_ArfGap2_3_like 12..127 CDD:350060 38/102 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.