DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and ArfGAP3

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster


Alignment Length:168 Identity:54/168 - (32%)
Similarity:79/168 - (47%) Gaps:20/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   712 PGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLD-DWPSPHLSVMLAIGN 775
            |.|..|.||.|..|.|:|:..|:.:||:||.||||||.|::.|||..|| :|....|..|...||
  Fly    24 PANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQLGGN 88

  Fly   776 SLANSVWE----SNTRQRVKPTSQASREDKERWVRSKYEAKEFLTPLGNGSSAHPSPSPGQQLIE 836
            :.|...:.    |.|..:||..|:|::..:::......:|.:     .:|:..|...:...:..|
  Fly    89 ANAAQFFRAHNCSTTDAQVKYNSRAAQLYRDKL
CAQAQQAMK-----THGTKLHLEQTDKSEGNE 148

  Fly   837 AVIRADIKSIVSILANCPSE----VTNANVSARDVRTP 870
            |....|      ..|.|.:|    |.|.|||.:|...|
  Fly   149 AAREED------FFAQCDNEVDFNVQNNNVSKQDPNPP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 39/110 (35%)
ANK <834..907 CDD:238125 13/41 (32%)
ANK repeat 834..866 CDD:293786 11/35 (31%)
Ank_5 859..907 CDD:290568 6/12 (50%)
ANK repeat 868..897 CDD:293786 1/3 (33%)
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 38/96 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464133
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.