DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and arfgap3

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_991160.1 Gene:arfgap3 / 402889 ZFINID:ZDB-GENE-040426-1 Length:498 Species:Danio rerio


Alignment Length:294 Identity:74/294 - (25%)
Similarity:122/294 - (41%) Gaps:69/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   700 DLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLD-DWP 763
            :::|:|...:....|..|.||.|.||.|||:..||.:||:|||.||:||.|:|.:||..|| :|.
Zfish     8 EISAVLKRLRAAAANKVCFDCSAKNPSWASITYGVFLCIDCSGTHRSLGVHLSFIRSTELDSNWS 72

  Fly   764 SPHLSVMLAIGNSLANSVW-----ESNTRQRVKPTSQASR--EDKERWVRSKYEAKEFLTPLGNG 821
            ...|..|...||:.||:.:     .|::....|.:|:|:.  .||.|.:.:: ..::..|.|...
Zfish    73 WFQLRCMQVGGNASANAFFSQHGCSSSSAANAKYSSRAAALYRDKIRALANQ-ATRQHGTELWLD 136

  Fly   822 SSAHPSPS----PGQQLIEAVIRADIKSIVSI-LANCPSEVTNANVSARDVRTPLLLACAIGNLA 881
            :.|..|||    ..:.......::.:...|.: ::.....|.:.|.:|:....|     ::..|:
Zfish   137 AQAPLSPSSPLDKQEDFFTQHTQSALPDTVQLNISQSQKRVQDNNNNAKSEAGP-----SVEQLS 196

  Fly   882 IAQLLIWNGANIKHTDHEGRTCLAYARAAQSLATAKSIKAAAAAQAGTTIPAPAPPTNGGIPAPQ 946
            ::.:                     ..||:.|:..|...||....||           ||..|  
Zfish   197 VSPV---------------------QSAAEPLSLLKKKPAAVRKSAG-----------GGRRA-- 227

  Fly   947 YNVEDTTALVELLEGLGCPEAAPLTASGTLPRRR 980
                          |||..:.:  :.|.||.:||
Zfish   228 --------------GLGAQKVS--SQSFTLQQRR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 44/123 (36%)
ANK <834..907 CDD:238125 6/73 (8%)
ANK repeat 834..866 CDD:293786 4/32 (13%)
Ank_5 859..907 CDD:290568 4/47 (9%)
ANK repeat 868..897 CDD:293786 2/28 (7%)
arfgap3NP_991160.1 ArfGap 10..123 CDD:279720 43/112 (38%)
PLN03114 11..486 CDD:178661 74/291 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.