DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and ArfGAP1

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster


Alignment Length:360 Identity:85/360 - (23%)
Similarity:121/360 - (33%) Gaps:147/360 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   714 NGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLA 778
            |..|.:||..||:|.|:..|:.:|:||||.||:||.|:|.|||:.:|.|....|..|.|.||..|
  Fly    19 NSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIELEKMKAGGNRNA 83

  Fly   779 NSVWES----NTR----QRVKPTSQASREDK-------ERW--------------------VRSK 808
            ....|.    |.|    ||....:.|...||       :.|                    ..|.
  Fly    84 REFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQGKSWDLKEAQGRVGSNNSFSSGGSSNSS 148

  Fly   809 YEAKEFLTPLG------NGSSAHPS---------------------------------PSPG--- 831
            |:::...|..|      ||..|.|.                                 ||.|   
  Fly   149 YQSRPSATGYGGNGGYQNGGGAEPGGYQQYQTQEFKDQKEEFFSRRQVENASRPENLPPSQGGKY 213

  Fly   832 ---------------QQLIEAVIR------ADIKSIVSILANCPSE--VTNANVSARDVRTPLLL 873
                           |:|.::.:.      :...:..|.||:...|  ||..|:::..::...||
  Fly   214 AGFGFTREPPPKTQSQELFDSTLSTLASGWSLFSTNASKLASTAKEKAVTTVNLASTKIKEGTLL 278

  Fly   874 ---ACAIGNLAIAQLLIWNGANIKHTDHEGRTCLAYARAAQSLATAKSIKAAAAAQAGTTIPAPA 935
               .|.:.::|           .|.|| .|:      |...:|             ||:.|.:| 
  Fly   279 DSVQCGVTDVA-----------SKVTD-MGK------RGWNNL-------------AGSNISSP- 311

  Fly   936 PPTNGGIPAPQYNVEDTTALV-------ELLEGLG 963
               .||...|  |.||::|..       .|..|||
  Fly   312 ---QGGYNDP--NFEDSSAYQRSNSVGGNLAGGLG 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 43/138 (31%)
ANK <834..907 CDD:238125 16/83 (19%)
ANK repeat 834..866 CDD:293786 8/39 (21%)
Ank_5 859..907 CDD:290568 9/50 (18%)
ANK repeat 868..897 CDD:293786 5/31 (16%)
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 37/94 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464129
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.