Sequence 1: | NP_723849.1 | Gene: | CenG1A / 34803 | FlyBaseID: | FBgn0028509 | Length: | 995 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021325699.1 | Gene: | acap3a / 322991 | ZFINID: | ZDB-GENE-030131-1711 | Length: | 845 | Species: | Danio rerio |
Alignment Length: | 438 | Identity: | 106/438 - (24%) |
---|---|---|---|
Similarity: | 158/438 - (36%) | Gaps: | 169/438 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 632 MKSSSVKANEADDNDGYEFYIVSLDSKQWHFEAANSEERDEWVAAVEQEIFK------------- 683
Fly 684 -------SLQSIESSKTKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECS 741
Fly 742 GVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQR--VKPTSQASREDKERW 804
Fly 805 VRSKYEAKEFLTPLGNG----------------------SSAHPSP--------SPGQQLIEAVI 839
Fly 840 RADIKSIVSILAN--------CPSEVTN------------------------------------- 859
Fly 860 ----------ANVS---------------------------------ARDV-------------- 867
Fly 868 --------RTPLLLACAIGNLAIAQLLIWNGANIKHTDHEGRTCLAYA 907 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CenG1A | NP_723849.1 | SelP_N | <5..41 | CDD:282453 | |
Centaurin_gamma | 143..300 | CDD:133303 | |||
RAS | 144..295 | CDD:214541 | |||
PH_AGAP | 451..686 | CDD:241281 | 16/73 (22%) | ||
PH | 454..>521 | CDD:278594 | |||
ArfGap | 702..818 | CDD:279720 | 55/117 (47%) | ||
ANK | <834..907 | CDD:238125 | 24/182 (13%) | ||
ANK repeat | 834..866 | CDD:293786 | 10/119 (8%) | ||
Ank_5 | 859..907 | CDD:290568 | 18/149 (12%) | ||
ANK repeat | 868..897 | CDD:293786 | 8/28 (29%) | ||
acap3a | XP_021325699.1 | BAR | 16..215 | CDD:325158 | |
PH_ACAP | 271..367 | CDD:270070 | 15/53 (28%) | ||
ArfGap | 403..520 | CDD:307528 | 55/116 (47%) | ||
ANK | 674..790 | CDD:238125 | 16/72 (22%) | ||
ANK repeat | 674..700 | CDD:293786 | 2/25 (8%) | ||
ANK repeat | 702..735 | CDD:293786 | 8/32 (25%) | ||
ANK repeat | 737..762 | CDD:293786 | 4/9 (44%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D751525at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |