DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and Agfg2

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_006249202.1 Gene:Agfg2 / 304375 RGDID:1306590 Length:488 Species:Rattus norvegicus


Alignment Length:306 Identity:64/306 - (20%)
Similarity:119/306 - (38%) Gaps:73/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   713 GNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLG-SHISKVRSLGLDDWPSPHLSVMLAIGNS 776
            ||..|.:|......:..:.:|..:|..|||:.|.|. .|  :|:|:.:..:..|.:..:.:.||.
  Rat    43 GNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLNPPH--RVKSISMTTFTEPEVLFLQSRGNE 105

  Fly   777 LANSVWES--NTRQRVKPTSQASREDKERWVRSKYEAKEFLTPLGNGSSAHPSPSPGQQLIEAVI 839
            :...:|..  :.|..:.|.|:..::.|| :::.|||.|.:..|        |....|....:..:
  Rat   106 VCRKIWLGLFDARTSLVPDSRDPQKVKE-FLQEKYEKKRWYVP--------PEQVK
GASYSKGSV 161

  Fly   840 RADIKSIVSILANCPSEVTNANVSARDVRTPLLLACAIGNLAIAQLLIWNGANIKHTDHEGRTCL 904
            .|             :.|..:....:.:||  ||...:.:|:.|.    :.::...:..:.||  
  Rat   162 SA-------------TPVQGSVPEGKPIRT--LLGDPVPSLSDAA----STSSQSVSQSQART-- 205

  Fly   905 AYARAAQSLATAKSIKAAA---AAQAGTTIPAP--AP------------PTNGGI---------- 942
            |.||::|..:.:.:.||:.   |...|....||  ||            |::||.          
  Rat   206 AQARSSQPPSHSSTKKASTDLLADIGGDPFAAPQVAPAFASFPGFGGQNPSHGGFANFDAFSSSP 270

  Fly   943 ---------PAPQ--YNVEDTTALVELLEGLGCPEAAPLTASGTLP 977
                     |:.|  :..:.|.|...:|.|.....::.::|.|..|
  Rat   271 SSSAFGSLPPSVQTPFQAQPTPAANRMLTGSYSFGSSQMSAFGVAP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 27/107 (25%)
ANK <834..907 CDD:238125 11/72 (15%)
ANK repeat 834..866 CDD:293786 2/31 (6%)
Ank_5 859..907 CDD:290568 9/47 (19%)
ANK repeat 868..897 CDD:293786 6/28 (21%)
Agfg2XP_006249202.1 ArfGap 40..152 CDD:295313 29/119 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.