DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and Appl1

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_038951064.1 Gene:Appl1 / 290537 RGDID:1309388 Length:720 Species:Rattus norvegicus


Alignment Length:677 Identity:135/677 - (19%)
Similarity:211/677 - (31%) Gaps:244/677 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 QQQLPLR-----MSA---DFAQAEQKLWSLQAASSSTINENNNITKYNPGAANSLQGDCSQVQLR 395
            :|:.||.     ||:   .|::...:|.|..|..|:.:             |:::....||.:.|
  Rat    70 KQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQL-------------ADAMMFPISQFKER 121

  Fly   396 DPRDLAPPPGKELPTPTSTP------TTSRKSRRRSNLFIPSSSKKADKEKEPKSSELGSGRSIP 454
            |.:::...  ||:....|..      ..||.|::|.|          ||.|...:.::.:.|.  
  Rat   122 DLKEILTL--KEVFQIASNDHDAAINRYSRLSKKREN----------DKVKYEVTEDVYTSRK-- 172

  Fly   455 IKQGYLYKRSSKSLNK-EWKKKYVTLCDDGRLTYHPSLHDYMDDVHGKEIPLQYVTVKVPGQKPR 518
             ||.........:||. ::|||...|                      |..|.|:..::...| .
  Rat   173 -KQHQTMMHYFCALNTLQYKKKIALL----------------------EPLLGYMQAQISFFK-M 213

  Fly   519 GSKSIITNSALTSSLMANGQRAQN----------TLSDGIGCLTLAKDN-------------QRK 560
            ||:::  |..|...|...|...||          |:...|..|.:|.|.             .|.
  Rat   214 GSENL--NGQLEEFLANIGTSVQNVRREMDGDVETMQQTIEDLEVASDPLYLPDPDPTKFPVNRN 276

  Fly   561 LSEKLSLLGA----GSIAA--------GAGGEPLKSNSSQQTSGD--EGIAMSNSNSQTFIAGEV 611
            |:.|...|.|    |.:::        ..||     |...|..||  .|:||...|         
  Rat   277 LTRKAGYLNARNKTGLVSSTWDRQFYFTQGG-----NLMSQARGDVAGGLAMDIDN--------- 327

  Fly   612 ANAGNKLEAQTPNVKKRHRRMKSSSVKANEADDNDGYEFYIVSLDSKQWH-FEAANSEERDEWVA 675
                                   .||.|.:.:|. .|.|.|.|.|.|:.. .:|.:.::.:||:.
  Rat   328 -----------------------CSVMAVDCEDR-RYCFQITSFDGKKSSILQAESKKDHEEWIC 368

  Fly   676 A---VEQEIFKSLQSIE-SSKTKQATSTDLAAMLAIRQR----VPGNGFCVDCGAPNPEWASLNL 732
            .   :.::|:.|....| :::..|:....:....:.:||    .||       |...|..|..: 
  Rat   369 TINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPG-------GQSRPPTARTS- 425

  Fly   733 GVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQRVKPTSQAS 797
                   .||   :|||..:.:.:|.||...:|...:..    .:.:.|.|....| .|...|..
  Rat   426 -------SSG---SLGSESTNLAALSLDSLVAPDTPIQF----DIISPVCEDQPGQ-AKAFGQGG 475

  Fly   798 REDKERWVRSKYEAKEFLTPLGNGSSAHPSPSPGQQLIEAVIRADIKSIVSILANCPSEVTNANV 862
            |.               ..|.|....:..|.:.|:                         |:.||
  Rat   476 RR---------------TNPFGESGGSTKSETEGR-------------------------TDCNV 500

  Fly   863 SARDVRTPLLLACAIGNLAIAQLLI---WNGANIKHTDHEG------RTCLAYARAAQS------ 912
            ..|          .|.|..:.||.|   .....:|..||..      |..|| |||..:      
  Rat   501 HPR----------VISNSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILA-ARAIHNIFRMTE 554

  Fly   913 ---LATAKSIKAAAAAQAGTTIPAPAP 936
               |.|...:|........|.:..|.|
  Rat   555 SHLLVTCDCLKLIDPQTQVTRLTFPLP 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 57/276 (21%)
PH 454..>521 CDD:278594 13/67 (19%)
ArfGap 702..818 CDD:279720 22/119 (18%)
ANK <834..907 CDD:238125 15/81 (19%)
ANK repeat 834..866 CDD:293786 3/31 (10%)
Ank_5 859..907 CDD:290568 14/56 (25%)
ANK repeat 868..897 CDD:293786 6/31 (19%)
Appl1XP_038951064.1 BAR_APPL1 20..234 CDD:153315 45/216 (21%)
BAR-PH_APPL 252..376 CDD:270067 32/161 (20%)
PTB_APPL 506..637 CDD:269980 19/77 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.