DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and Git2

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_006530402.1 Gene:Git2 / 26431 MGIID:1347053 Length:761 Species:Mus musculus


Alignment Length:212 Identity:66/212 - (31%)
Similarity:104/212 - (49%) Gaps:18/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 QRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAI 773
            :|:..:..|.||..|:|.|||:|.|..:|.||..|||:||.|||:||.|....||...|.::..:
Mouse     3 KRLRSSDVCADCNGPDPSWASVNRGTFICDECCSVHRSLGRHISQVRHLKHTAWPPTLLQMVETL 67

  Fly   774 GNSLANSVWESNT---------RQRVKPTSQASREDKERWVRSKYEAKEFL--TPLGNGSSAHPS 827
            .|:.|||:||.:.         |::..|..:. ..:|..::|:||:...|:  .|.....|. .:
Mouse    68 YNNGANSIWEHSLLDPASIMSGRRKANPQDKV-HPNKAEFIRAKYQMLAFVHRLPCREDDSV-TA 130

  Fly   828 PSPGQQLIEAVIRADIKSIVSILANCPSEVTNAN-VSARDVRTPLLLACAIGNLAIAQLLIWNGA 891
            ....:||..:|...::::.:.:|    |....|| .......|||.:|...|.:..|:||...||
Mouse   131 KDLSKQLHSSVRTGNLETCLRLL----SLGAQANFFHPEKGSTPLHVASKAGQILQAELLAVYGA 191

  Fly   892 NIKHTDHEGRTCLAYAR 908
            :....|..|:|.:.|||
Mouse   192 DPGTQDSSGKTPVDYAR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 41/119 (34%)
ANK <834..907 CDD:238125 19/73 (26%)
ANK repeat 834..866 CDD:293786 6/32 (19%)
Ank_5 859..907 CDD:290568 15/48 (31%)
ANK repeat 868..897 CDD:293786 10/28 (36%)
Git2XP_006530402.1 ArfGap_GIT2 1..111 CDD:350072 38/108 (35%)
Ank_2 137..229 CDD:372319 22/76 (29%)
ANK repeat 137..165 CDD:293786 6/31 (19%)
ANK repeat 167..197 CDD:293786 10/29 (34%)
GIT_SHD 268..296 CDD:369921
GIT_SHD 332..360 CDD:369921
GIT_CC 416..480 CDD:374629
GIT1_C 640..754 CDD:371961
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.