DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and APPL1

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_036228.1 Gene:APPL1 / 26060 HGNCID:24035 Length:709 Species:Homo sapiens


Alignment Length:470 Identity:91/470 - (19%)
Similarity:152/470 - (32%) Gaps:160/470 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 SRKSRRRSNLFIPSSSKKADKEKEPKSSELGSGRSIPIKQGYLYKRSSKSLNK-EWKKKYVTLCD 481
            ||.|::|.|          ||.|...:.::.:.|.   ||.........:||. ::|||...|  
Human   148 SRLSKKREN----------DKVKYEVTEDVYTSRK---KQHQTMMHYFCALNTLQYKKKIALL-- 197

  Fly   482 DGRLTYHPSLHDYMDDVHGKEIPLQYVTVKVPGQKPRGSKSIITNSALTSSLMANGQRAQN---- 542
                                |..|.|:..::...| .||:::  |..|...|...|...||    
Human   198 --------------------EPLLGYMQAQISFFK-MGSENL--NEQLEEFLANIGTSVQNVRRE 239

  Fly   543 ------TLSDGIGCLTLAKDN-------------QRKLSEKLSLLGA----GSIAA--------G 576
                  |:...|..|.:|.|.             .|.|:.|...|.|    |.:::        .
Human   240 MDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQFYFT 304

  Fly   577 AGGEPLKSNSSQQTSGD--EGIAMSNSNSQTFIAGEVANAGNKLEAQTPNVKKRHRRMKSSSVKA 639
            .||     |...|..||  .|:||...|                                .||.|
Human   305 QGG-----NLMSQARGDVAGGLAMDIDN--------------------------------CSVMA 332

  Fly   640 NEADDNDGYEFYIVSLDSKQWH-FEAANSEERDEWVAAVEQEIFKSLQSIESSKTKQATSTDLAA 703
            .:.:|. .|.|.|.|.|.|:.. .:|.:.::.:||:..: ..|.|.:...|:.: :.|...:.:|
Human   333 VDCEDR-RYCFQITSFDGKKSSILQAESKKDHEEWICTI-NNISKQIYLSENPE-ETAARVNQSA 394

  Fly   704 MLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHR----------NLGSHISKVRSLG 758
            :.|:              .|:|.:...:..:.   ..:|..|          :|||..:.:.:|.
Human   395 LEAV--------------TPSPSFQQRHESLR---PAAGQSRPPTARTSSSGSLGSESTNLAALS 442

  Fly   759 LDDWPSPHLSVMLAIGNSLANSVWESNTRQ---------RVKPTSQ---ASREDKERWVRSKYEA 811
            ||...:|...:..    .:.:.|.|....|         |..|..:   :::.:.|..:..:...
Human   443 LDSLVAPDTPIQF----DIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFI 503

  Fly   812 KEFLTPLGNGSSAHP 826
            ..||..:...|..||
Human   504 VRFLGSMEVKSDDHP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 57/273 (21%)
PH 454..>521 CDD:278594 13/67 (19%)
ArfGap 702..818 CDD:279720 21/137 (15%)
ANK <834..907 CDD:238125
ANK repeat 834..866 CDD:293786
Ank_5 859..907 CDD:290568
ANK repeat 868..897 CDD:293786
APPL1NP_036228.1 Required for RAB5A binding 1..428 73/374 (20%)
BAR_APPL1 20..234 CDD:153315 27/123 (22%)
BAR-PH_APPL 252..376 CDD:270067 33/162 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..434 7/53 (13%)
F&H 403..414 0/13 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..491 3/23 (13%)
PTB_APPL 490..625 CDD:269980 6/29 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..709
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.