DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and glo3

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_594843.2 Gene:glo3 / 2541825 PomBaseID:SPAC22E12.17c Length:483 Species:Schizosaccharomyces pombe


Alignment Length:350 Identity:83/350 - (23%)
Similarity:141/350 - (40%) Gaps:76/350 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   674 VAAVEQEIFKSLQSIESSKTKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCI 738
            :.|.::|..|.|.|:.|.:                    .|..|.||||.||.|:|...|:.:|:
pombe     1 MTATKEESQKLLTSLRSQR--------------------DNKVCFDCGAKNPTWSSTTFGIYLCL 45

  Fly   739 ECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWES-------NTRQ-RVKPTSQ 795
            :||..|||:|.|||.|||..||.|....|.||...||..|.:.::.       |::. |:|.:|:
pombe    46 DCSAAHRNMGVHISFVRSTVLDSWTYAQLRVMRVGGNENARNYFKRHGGVSLLNSKDCRLKYSSK 110

  Fly   796 ASRE--DKERWVRSKYEAK-------EFLTPLGNGSSAHPSPSPGQQLIEAVIRADIKSI----- 846
            .:::  :|.:.:..:.||.       :||:....||||..:.:.......|..:|.:|..     
pombe   111 TAKQYLEKLKSLAVEDEANYPDILDMDFLSNTHEGSSAADTTNEDDDFFSAWDKASVKKSDDNLD 175

  Fly   847 -VSILANCPSEVTNANVSARDVRTPLLLACAIGNLAIAQLLIWNGANIKHTDHEGRTCLAYARAA 910
             .:.||:..|.|.   |.:.:...|:::.                        |.:|.::.....
pombe   176 DKTDLASTSSSVV---VESGEKDEPVVVT------------------------EEKTMVSPPSRP 213

  Fly   911 QSLATAKSIKAAAAAQAGTTIPAPAPPTNG--GIPAPQ-YNVEDTTALV---ELLEGLGCPEAAP 969
            .|.:|.||..::.::.....|.|.:.||..  |...|| ..::...|.:   |..:.:...|:||
pombe   214 DSTSTTKSKTSSISSARARPIRASSRPTASKLGASRPQKLGIKKANADIDFDEFEKAVLSSESAP 278

  Fly   970 LTASGTLPRRRDTLGTPYEKSVSGV 994
            ......:..:..|:.|..:..|..|
pombe   279 TKKPAAVASKESTVDTLVDNGVEEV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 3/11 (27%)
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 42/132 (32%)
ANK <834..907 CDD:238125 11/78 (14%)
ANK repeat 834..866 CDD:293786 8/37 (22%)
Ank_5 859..907 CDD:290568 4/47 (9%)
ANK repeat 868..897 CDD:293786 1/28 (4%)
glo3NP_594843.2 COG5347 2..348 CDD:227651 82/348 (24%)
ArfGap 12..128 CDD:214518 41/135 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.