DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and ucp3

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_596008.1 Gene:ucp3 / 2540709 PomBaseID:SPBC21D10.05c Length:601 Species:Schizosaccharomyces pombe


Alignment Length:129 Identity:53/129 - (41%)
Similarity:72/129 - (55%) Gaps:4/129 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   706 AIR---QRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHL 767
            |||   |.|.||..|.||.....:|||.|||:.:|:.|:.:||.||:|:|||:|:.||:|.:..:
pombe     9 AIRELVQSVSGNNLCADCSTRGVQWASWNLGIFLCLRCATIHRKLGTHVSKVKSISLDEWSNDQI 73

  Fly   768 SVMLAIGNSLANSVWESNTRQRVKPTSQASRED-KERWVRSKYEAKEFLTPLGNGSSAHPSPSP 830
            ..|...||..||..|..|......||:..|.|. .|:::|.|||.|.||....:.:|..||..|
pombe    74 EKMKHWGNINANRYWNPNPLSHPLPTNALSDEHVMEKYIRDKYERKLFLDENHSTNSKPPSLPP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 49/115 (43%)
ANK <834..907 CDD:238125
ANK repeat 834..866 CDD:293786
Ank_5 859..907 CDD:290568
ANK repeat 868..897 CDD:293786
ucp3NP_596008.1 COG5347 1..360 CDD:227651 53/129 (41%)
ArfGap 7..125 CDD:279720 49/115 (43%)
UBA_like_SF 157..196 CDD:304366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I1799
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.