DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and ACAP2

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_016861535.1 Gene:ACAP2 / 23527 HGNCID:16469 Length:848 Species:Homo sapiens


Alignment Length:706 Identity:155/706 - (21%)
Similarity:243/706 - (34%) Gaps:239/706 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 TSRKSRRRSNLFIPSSSKK---ADKEKEPKSSELGSGRSIPIKQGYLYKRSSKSLNKEWKKKYVT 478
            |.|..:.:...|:....:|   |.|:.|..|.|         |:..|.|.:....||:.:.:..|
Human   129 TQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEE---------KENALVKNAQVQRNKQHEVEEAT 184

  Fly   479 -LCDDGRLTYHPSLHDYMDDVHGKEIPLQYV-TVKVPGQKPRGS--KSIIT-------------- 525
             :....|..:             :.|.|.|| .:.|...|.|..  ||:::              
Human   185 NILTATRKCF-------------RHIALDYVLQINVLQSKRRSEILKSMLSFMYAHLAFFHQGYD 236

  Fly   526 -NSALTSSLMANGQRAQNTLSDGIGCLTLAKDNQRKLSEKLSLLGAGSIAAGAGGEPLKSNSSQQ 589
             .|.|...:...|.:....:.|       |...:|::.:|.|.:.....::.      .|.....
Human   237 LFSELGPYMKDLGAQLDRLVVD-------AAKEKREMEQKHSTIQQKDFSSD------DSKLEYN 288

  Fly   590 TSGDEGIAMSNSNSQTFIAGEVANAGNKLEAQTPNVKKR-----------HRRMKSS-------- 635
            .....||.|     :.::....:||......:.|:..:|           .::.|.:        
Human   289 VDAANGIVM-----EGYLFKRASNAFKTWNRKKPDHIRRWFSIQNNQLVYQKKFKDNPTVVVEDL 348

  Fly   636 ---SVKANEADDNDGYEFYIVSLDSKQWHFEAANSEERDEWVAAVEQEIFKSL--QSIESSKTKQ 695
               :||..| |....:.|.:|| .:|....:|.:.:.|..|:.||:..|..:.  :..||.|..:
Human   349 RLCTVKHCE-DIERRFCFEVVS-PTKSCMLQADSEKLRQAWIKAVQTSIATAYREKGDESEKLDK 411

  Fly   696 ATSTDLAAM----------------LAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVH 744
            .:|....::                |...|.:|||..|.|||..:|.|||:|||:.:||||||:|
Human   412 KSSPSTGSLDSGNESKEKLLKGESALQRVQCIPGNASCCDCGLADPRWASINLGITLCIECSGIH 476

  Fly   745 RNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNT-RQRVKPTSQASREDKERWVRSK 808
            |:||.|.||||||.||.|....|.:|..:||.:.|.|:|:|. :..:|......|::||.::|:|
Human   477 RSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYEANVEKMGIKKPQPGQRQEKEAYIRAK 541

  Fly   809 YEAKEF-------LTP---------------------LGNGSSAHPS------------------ 827
            |..::|       |:|                     .|.|.....|                  
Human   542 YVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGDQVRASAQSSVIAVNSDEARRESL 606

  Fly   828 ----------------------------------------PS----------------------- 829
                                                    ||                       
Human   607 FCPDELDSLFSYFDTSSKLRSIRSNDSGIQQSSDDGRESLPSTVSANSLYEPEGERQDSSMFLDS 671

  Fly   830 ----PGQQLIEAVIRADIKSIVSILANCPSEVTNANVSARDVRTPLLLACAIGNLAIAQLLIWNG 890
                ||.||..|....::..:...||: .::|..|| |..:..|||:.|...|:|...:.|:.||
Human   672 KHLNPGLQLYRASYEKNLPKMAEALAH-GADVNWAN-SEENKATPLIQAVLGGSLVTCEFLLQNG 734

  Fly   891 ANIKHTD--------------HEGRTCLAYARAAQSLATAKSIK-----AAAAAQA 927
            ||:...|              |.|:.||...|.|...||.:..|     |..||.|
Human   735 ANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLSIAVEAANA 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 47/277 (17%)
PH 454..>521 CDD:278594 14/70 (20%)
ArfGap 702..818 CDD:279720 54/160 (34%)
ANK <834..907 CDD:238125 24/86 (28%)
ANK repeat 834..866 CDD:293786 8/31 (26%)
Ank_5 859..907 CDD:290568 19/61 (31%)
ANK repeat 868..897 CDD:293786 11/28 (39%)
ACAP2XP_016861535.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R258
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.