DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and Appl2

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_660255.1 Gene:Appl2 / 216190 MGIID:2384914 Length:662 Species:Mus musculus


Alignment Length:583 Identity:98/583 - (16%)
Similarity:191/583 - (32%) Gaps:204/583 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 DDGRLT-YHPSLHDYMDDVHGKEIPLQYVTVKVPGQ----------KPRGSKSIITNSALTSSLM 534
            |.|.|| |...|...|..|:|.:..:...|.::..|          ..:|.:.:|:.....|.:|
Mouse    29 DAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSRQLLAYEKQNFALGKGDEEVISTLHYFSKVM 93

  Fly   535 --ANGQRAQ--NTLSDGIGCLTLAKDNQRKLSEKLSLLGAGSIAAGAGGEPLKSNSSQQTSGDEG 595
              .||...:  ..|:|.: .|.:.:..::.|:|..:|.....:|                |.:..
Mouse    94 DELNGLHTELAKQLADTM-VLPVIQFREKDLTEVSTLKDLFGLA----------------SSEHD 141

  Fly   596 IAMS----------NSNSQTFIAGEVANAGNKLEAQTPNVKKRHRRMKSSSVKANEADDNDGYEF 650
            ::|:          |..::|.|..|||.|              .|:...||::            
Mouse   142 LSMAKYSRLPKKKENEKAKTEIVKEVAAA--------------RRKQHLSSLQ------------ 180

  Fly   651 YIVSLDSKQWHFEAAN----------------------SEERDEWVAAVEQEIFKSLQ-SIESSK 692
            |..:|::.|:...||.                      |:..|.::::| :::.:|:| .:|:..
Mouse   181 YYCALNALQYRKRAAMMEPLIGFAHGQINFFKRGAEMFSKSMDGFLSSV-KDMVQSIQVELEAEA 244

  Fly   693 TKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSL 757
            .|...|..  .:|::.:.|         ..|:.:.|:           :.::|||          
Mouse   245 DKMRVSQQ--ELLSVSESV---------YTPDIDVAT-----------AQINRNL---------- 277

  Fly   758 GLDDWPSPHLSVMLAIGNSLANSVWESNTRQRVKPTSQASREDKERWVRSKYEAKEFLTPLGNGS 822
                                            ::.|...:..:|...|.:.:|...|.|..|| .
Mouse   278 --------------------------------IQKTGYLNLRNKTGLVTTTWERLYFFTQGGN-L 309

  Fly   823 SAHPSPSPGQQLIEAVIRADIKSIVSILANCPSEVTNANVSARDVRTPLLL-----------ACA 876
            ...|..:....||:     |:.:...:..:|........:|....:..::|           .||
Mouse   310 MCQPRGAVAGGLIQ-----DLDNCSVMAVDCEDRRYCFQISTPSGKPGIILQAESRKEYEEWICA 369

  Fly   877 IGNLAIAQLLIWN----GANIKHTDHEGRTCL-AYARAAQSLATAKSIKAA------AAAQAGTT 930
            :.|::....|..|    ...:..|..:..|.: ::.:..:|..::::||.:      ...:|..:
Mouse   370 VNNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCSSQNIKNSDIEDDNIVPKATAS 434

  Fly   931 IP------APAPPTNGGI--PAPQYNVEDTTALVELLEGLGCPEAAPL--TASGTLPRRRDTL 983
            ||      ||..|....|  ||.::          |.:..|.....|.  |..|:.|...|:|
Mouse   435 IPETEELIAPGTPIQFDIVLPATEF----------LDQNRGGRRTNPFGETEDGSFPEAEDSL 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 45/251 (18%)
PH 454..>521 CDD:278594 12/50 (24%)
ArfGap 702..818 CDD:279720 13/115 (11%)
ANK <834..907 CDD:238125 13/88 (15%)
ANK repeat 834..866 CDD:293786 5/31 (16%)
Ank_5 859..907 CDD:290568 9/63 (14%)
ANK repeat 868..897 CDD:293786 6/43 (14%)
Appl2NP_660255.1 BAR_APPL2 20..234 CDD:153316 44/248 (18%)
BAR-PH_APPL 252..376 CDD:270067 25/193 (13%)
PH 278..378 CDD:278594 18/105 (17%)
PH domain 278..376 18/103 (17%)
PTB_APPL 480..613 CDD:269980 3/8 (38%)
PTB domain 491..607
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 642..662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.