DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and git-1

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_509761.2 Gene:git-1 / 181253 WormBaseID:WBGene00008805 Length:670 Species:Caenorhabditis elegans


Alignment Length:219 Identity:66/219 - (30%)
Similarity:96/219 - (43%) Gaps:16/219 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   696 ATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLD 760
            |.:.||...|..::       |.|||....||||:..|.::|.||...|..||..:|.:|.|...
 Worm     4 AEALDLITSLEQKE-------CDDCGKKEVEWASVKKGTVICSECFCFHSYLGPSVSYLRHLRKS 61

  Fly   761 DWPSPHLSVMLAIGNSLANSVWES----NTRQRVKPTSQASREDKERWVRSKYEAKEFLTPLGNG 821
            .|...|:.::.|:..|..|.:|||    .:.:..||.:|.....||::|:.|||...|....|..
 Worm    62 AWDEEHIRLVHALNTSNTNMIWESALYEGSTKFQKPMAQDPSHIKEQFVKEKYEKLTFQPKRGKD 126

  Fly   822 SSAHPSPSPGQQLIEAVIRADIKSIVSILANCPSEVTNANVSARDVRTPLLLACAIGNLAIAQLL 886
            .....|.:  :||| |..|:|...:...|....::|...:....|  |.|.:|...||....:||
 Worm   127 EDLENSLN--RQLI-ACARSDFAHVTLRLIALGADVNYPDPETGD--TALHVAAREGNSNQVELL 186

  Fly   887 IWNGANIKHTDHEGRTCLAYARAA 910
            ...||:|...:.||......||.|
 Worm   187 FLYGADIMAPNREGMLPYILARDA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 37/119 (31%)
ANK <834..907 CDD:238125 20/72 (28%)
ANK repeat 834..866 CDD:293786 7/31 (23%)
Ank_5 859..907 CDD:290568 13/47 (28%)
ANK repeat 868..897 CDD:293786 10/28 (36%)
git-1NP_509761.2 ArfGap 7..127 CDD:214518 40/126 (32%)
ANK <122..212 CDD:238125 26/94 (28%)
Ank_5 152..207 CDD:290568 15/56 (27%)
ANK repeat 165..197 CDD:293786 11/33 (33%)
GIT 264..294 CDD:128828
GIT 326..356 CDD:128828
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.