DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and Acap3

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_997106.1 Gene:Acap3 / 140500 MGIID:2153589 Length:833 Species:Mus musculus


Alignment Length:737 Identity:149/737 - (20%)
Similarity:226/737 - (30%) Gaps:348/737 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 PTTSRKSRRRSNLFIPSSSKKADKEK-----------------EPKSSELGSGRSIPIKQGYLYK 462
            |...:.:.....|.|.|:.:|.:.|:                 |||........|..:.:|||:|
Mouse   213 PYMKKLAAELDQLVIDSAVEKREMERKHAAIQQRTLLQDFSYDEPKVEFDVDAPSGVVMEGYLFK 277

  Fly   463 RSSKSLNKEWKKKYVTLCDDGRLTYHPSLHDYMDDVHGKEIPLQYVTVKVPGQKPRGSKSIITNS 527
            |:|.:. |.|.:::.:: .:.:|.|...|.|                                  
Mouse   278 RASNAF-KTWNRRWFSI-QNSQLVYQKKLKD---------------------------------- 306

  Fly   528 ALTSSLMANGQRAQNTLSDGIGCLTLAKDNQRKLSEKLSLLGAGSIAAGAGGEPLKSNSSQQTSG 592
                                  .||:..|:.|..|.|                |.:         
Mouse   307 ----------------------ALTVVVDDLRLCSVK----------------PCE--------- 324

  Fly   593 DEGIAMSNSNSQTFIAGEVANAGNKLEAQTPNVKKRHRRMKSSSVKANEADDNDGYEFYIVSLDS 657
                                           ::::|                   :.|.:|| .:
Mouse   325 -------------------------------DIERR-------------------FCFEVVS-PT 338

  Fly   658 KQWHFEAANSEERDEWVAAVEQEIFK--------------------SLQSIESSKTKQATSTDLA 702
            |....:|.:.:.|..||.||:..|..                    |..||:|:...:.......
Mouse   339 KSCMLQADSEKLRQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSIDSTTDSRERGVKGE 403

  Fly   703 AMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHL 767
            ::|...|.|.||..|.|||.|:|.|||:|||||:||||||:||:||.|.||||||.||.|....|
Mouse   404 SVLQRVQSVAGNSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELL 468

  Fly   768 SVMLAIGNSLANSVWES-----NTRQRVKPTSQASREDKERWVRSKYEAKEFLTPLGNGSS---- 823
            .:|..:|||..|.::|:     ..|   |||:.:||:|||.|::.||..|:||..|.:..:    
Mouse   469 KLMCELGNSTVNQIYEAQCEGPGVR---KPTASSSRQDKEAWIKDKYVEKKFLRKLTSAPAREPP 530

  Fly   824 ----------AHPSP-------------------------------------------------- 828
                      .|.||                                                  
Mouse   531 RRWRAQKCQRPHSSPHAPTTRRKVRLEPVLPSVAALSSAATMERKFRRDSLFCPDELDSLFSYFD 595

  Fly   829 ----------------------------------------------------------------- 828
                                                                             
Mouse   596 AGAAGAGPRSLSSDSGLGGSSDGSSDVLAFGTGSVVDSVTEEEGAESEESSSEVDGEAEAWSLAD 660

  Fly   829 ----SPGQQLIEAVIRADIKSIVSILANCPSEVTNANVSARDVRTPLLLACAIGNLAIAQLLIWN 889
                .||....:|....|:.::.:.||: .:||..|: :|.:.:|||:.|...|:|.:.:.|:.|
Mouse   661 VRELHPGLLAHQAARTRDLPALAAALAH-GAEVNWAD-AADEGKTPLVQAVLGGSLIVCEFLLQN 723

  Fly   890 GANIKHTDHEGR--------------TCLAYARAAQSLATAK--------SIKAA---------A 923
            ||::...|..||              .||...|.|...|..:        :::||         .
Mouse   724 GADVNQRDSLGRAPLHHATLLGRTGQVCLFLKRGADQHALDQEQQDPLTIAVQAANADIVTLLRL 788

  Fly   924 AAQAGTTIPAPAPPTNGGIPAP 945
            |..|.....|.|||   |.|.|
Mouse   789 ARMAEEMREAEAPP---GQPGP 807

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 33/254 (13%)
PH 454..>521 CDD:278594 12/66 (18%)
ArfGap 702..818 CDD:279720 61/120 (51%)
ANK <834..907 CDD:238125 23/86 (27%)
ANK repeat 834..866 CDD:293786 8/31 (26%)
Ank_5 859..907 CDD:290568 17/61 (28%)
ANK repeat 868..897 CDD:293786 10/28 (36%)
Acap3NP_997106.1 BAR_ACAP3 16..215 CDD:153321 1/1 (100%)
PH 269..363 CDD:278594 30/227 (13%)
PH_ACAP 271..367 CDD:270070 31/229 (14%)
ArfGap 403..521 CDD:279720 61/120 (51%)
ANK 671..786 CDD:238125 28/116 (24%)
Ank_2 671..764 CDD:289560 26/94 (28%)
ANK repeat 700..731 CDD:293786 10/30 (33%)
ANK repeat 733..764 CDD:293786 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R258
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.