DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and AgaP_AGAP000563

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_310516.5 Gene:AgaP_AGAP000563 / 1271660 VectorBaseID:AGAP000563 Length:983 Species:Anopheles gambiae


Alignment Length:391 Identity:97/391 - (24%)
Similarity:149/391 - (38%) Gaps:106/391 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 GSGRSIPIKQGYLYKRSSKSLNKEWKKKYVTLCDDGRLTYHPSLHDYMDDVHGKEIP------LQ 506
            |..|:....:|||:||:|.:. |.|.:::..: .|.:|.|....        |:|:|      |:
Mosquito   297 GGARTPSYMEGYLFKRTSNAF-KTWNRRWFCM-RDNQLFYRKRT--------GEELPTVMEEDLR 351

  Fly   507 YVTVKVPGQKPRGSKSIITNSALTSSLMANGQRAQN----TLSDGIGCLTLAKDNQRKLSEKLSL 567
            ..||:......|.....:.:...:..|.|:.:...:    .|..||.  :..:.|....|:...|
Mosquito   352 LCTVRQLADSDRRYCFEVISPTKSHILQADSEAMMSAWIKALQKGID--SAIQHNSGYSSDMRGL 414

  Fly   568 LGAGSIAAGAGGEPLKSNSSQQTSGDEGIAMSNSNSQTFIAGEVANAGNKLEAQTPNVKKRHRRM 632
            ...|....|.||......::...||..|...::::.:     |.|..|...:......||.:   
Mosquito   415 AAGGGPGGGVGGPGGSGAAAASDSGRPGDGRTDASGR-----ERAGTGRASDGSRKGFKKIN--- 471

  Fly   633 KSSSVKANEADDNDGYEFYIVSLDSKQWHFEAANSEERDEWVAAVEQEIFKSLQSIESSKTKQAT 697
                                                    |...:                    
Mosquito   472 ----------------------------------------WTQML-------------------- 476

  Fly   698 STDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDW 762
                        ::|||..|.|||..:|.|||:|||:.:||.||||||:||.|.||||||.||.|
Mosquito   477 ------------KIPGNSRCADCGNADPRWASINLGITLCIACSGVHRSLGVHYSKVRSLTLDVW 529

  Fly   763 PSPHLSVMLAIGNSLANSVWESNTRQRV---KPTSQASREDKERWVRSKYEAKEFLTPLGN-GSS 823
            ....|.||:.:||.:.|.|:|.|..:..   :.|.......:|.|:|:||..::|:.|||. ||.
Mosquito   530 EPEILRVMIELGNDVINRVYEGNAARLARFDRATDNCEIAVREAWIRAKYIDRQFVVPLGGLGSG 594

  Fly   824 A 824
            |
Mosquito   595 A 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 40/244 (16%)
PH 454..>521 CDD:278594 18/72 (25%)
ArfGap 702..818 CDD:279720 50/118 (42%)
ANK <834..907 CDD:238125
ANK repeat 834..866 CDD:293786
Ank_5 859..907 CDD:290568
ANK repeat 868..897 CDD:293786
AgaP_AGAP000563XP_310516.5 BAR_3 6..239 CDD:293351
PH 304..397 CDD:278594 21/102 (21%)
PH_ACAP 305..400 CDD:270070 23/106 (22%)
ArfGap 469..585 CDD:279720 51/190 (27%)
ANK 777..896 CDD:238125
Ank_2 780..874 CDD:289560
ANK repeat 780..806 CDD:293786
ANK repeat 812..841 CDD:293786
ANK repeat 843..874 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.