DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and AgaP_AGAP007379

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_308452.4 Gene:AgaP_AGAP007379 / 1269802 VectorBaseID:AGAP007379 Length:383 Species:Anopheles gambiae


Alignment Length:107 Identity:43/107 - (40%)
Similarity:62/107 - (57%) Gaps:9/107 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   713 GNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSL 777
            ||..|.||.:.|.||||.|:|:.:|..|..|||::|:|||||:.|.||.|....:..|:.:||..
Mosquito    17 GNSICADCDSKNLEWASYNIGIFLCTRCCAVHRSMGAHISKVKHLKLDKWEDSQIQRMIDVGNKS 81

  Fly   778 ANSVWESNTRQRVKPTSQASREDK-----ERWVRSKYEAKEF 814
            |...:|:    ||....:..:|:.     |:|:|:|||..||
Mosquito    82 ARLKYEN----RVPACYRRPKENDPQILIEQWIRAKYERLEF 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 43/107 (40%)
ANK <834..907 CDD:238125
ANK repeat 834..866 CDD:293786
Ank_5 859..907 CDD:290568
ANK repeat 868..897 CDD:293786
AgaP_AGAP007379XP_308452.4 ArfGap 6..123 CDD:279720 43/107 (40%)
PH1_ADAP 130..237 CDD:270072
PH 132..225 CDD:278594
PH2_ADAP 251..354 CDD:241282
PH 253..353 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.