DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CenG1A and ADAP1

DIOPT Version :9

Sequence 1:	NP_723849.1	Gene:	CenG1A / 34803	FlyBaseID:	FBgn0028509	Length:	995	Species:	Drosophila melanogaster
Sequence 2:	NP_001271237.1	Gene:	ADAP1 / 11033	HGNCID:	16486	Length:	385	Species:	Homo sapiens

Alignment Length:	95	Identity:	38/95 - (40%)
Similarity:	59/95 - (62%)	Gaps:	2/95 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   724 NPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQ 788
            :|:|||..|||.:|:.|||:|||: ..:|||:|:.||.|....:..|.:.||..|.:.:||....
Human    39 DPDWASYTLGVFICLSCSGIHRNI-PQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPS 102

  Fly   789 -RVKPTSQASREDKERWVRSKYEAKEFLTP 817
             ..:||....:..:|:|:|:|||.:||:.|
Human   103 FYYRPTPSDCQLLREQWIRAKYERQEFIYP 132

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CenG1A	NP_723849.1	SelP_N	<5..41	CDD:282453
		Centaurin_gamma	143..300	CDD:133303
		RAS	144..295	CDD:214541
		PH_AGAP	451..686	CDD:241281
		PH	454..>521	CDD:278594
		ArfGap	702..818	CDD:279720	38/95 (40%)
		ANK	<834..907	CDD:238125
		ANK repeat	834..866	CDD:293786
		Ank_5	859..907	CDD:290568
		ANK repeat	868..897	CDD:293786
ADAP1	NP_001271237.1	ArfGap	28..137	CDD:214518	38/95 (40%)
		PH1_ADAP	141..249	CDD:270072
		PH	142..239	CDD:278594
		PH2_ADAP	263..368	CDD:241282
		PH	266..366	CDD:278594
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5347
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.900