DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and smap2

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_002938524.3 Gene:smap2 / 100496482 XenbaseID:XB-GENE-5817085 Length:422 Species:Xenopus tropicalis


Alignment Length:135 Identity:53/135 - (39%)
Similarity:78/135 - (57%) Gaps:16/135 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 KSLQSIESSKTKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNL 747
            ||::.:|   ..||..::    |.:|:.   |.||.||.|..|.|||.|:||.:||.|:||||||
 Frog     4 KSVRDVE---RYQAVLSE----LLLREE---NKFCADCLAKGPRWASWNIGVFVCIRCAGVHRNL 58

  Fly   748 GSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQR-VKP-TSQASREDKERWVRSKYE 810
            |.|||:|:|:.||.|....:..|..:||..|..::|:..... ::| |.||    .|.::|.|||
 Frog    59 GVHISRVKSVNLDQWTQEQIQCMEEMGNGKAKRLYEAFLPDNFIRPQTDQA----VEVFIREKYE 119

  Fly   811 AKEFL 815
            .|:::
 Frog   120 KKKYM 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 2/2 (100%)
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 48/116 (41%)
ANK <834..907 CDD:238125
ANK repeat 834..866 CDD:293786
Ank_5 859..907 CDD:290568
ANK repeat 868..897 CDD:293786
smap2XP_002938524.3 ArfGap_SMAP2 16..122 CDD:350083 47/116 (41%)
Med15 270..>411 CDD:312941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.