DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and smap1

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_001120382.1 Gene:smap1 / 100145457 XenbaseID:XB-GENE-979112 Length:471 Species:Xenopus tropicalis


Alignment Length:219 Identity:67/219 - (30%)
Similarity:100/219 - (45%) Gaps:39/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   703 AMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHL 767
            |:|:...|...|.:|.||.|..|.|||.||||.:||.|:|:|||||.|||:|:|:.||.|....:
 Frog    19 AILSRMLREEDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQM 83

  Fly   768 SVMLAIGNSLANSVWESNTRQRV-KPTSQASREDKERWVRSKYEAKEF-----LTPLGNGSSAHP 826
            ..|..:||:.|..::|:|..:.. :|.:..|   .|.::|.|||.|::     ..|....||...
 Frog    84 QCMQDMGNTKARQMYEANLPENFRRPQTDQS---VEFFIRDKYERKKYYDKNATVPGITSSSDAV 145

  Fly   827 SPSPGQQLIEAVI-------------------RADIKSIVSILAN------CPSEVTNANVSARD 866
            .||.....:::..                   |...||:..:.|:      .|.|     |.|..
 Frog   146 QPSASSPSLQSAAEKSKLEKEKDRKKEERKKEREPEKSLKPVGADKVLKKELPLE-----VKASP 205

  Fly   867 VRTPLLLACAIGNLAIAQLLIWNG 890
            .::|.|....:|..|.|:..:.||
 Frog   206 KKSPELTVDLLGLDAPAETSVSNG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 47/120 (39%)
ANK <834..907 CDD:238125 15/82 (18%)
ANK repeat 834..866 CDD:293786 8/56 (14%)
Ank_5 859..907 CDD:290568 9/32 (28%)
ANK repeat 868..897 CDD:293786 7/23 (30%)
smap1NP_001120382.1 ArfGap_SMAP 21..123 CDD:350068 42/104 (40%)
Med15 <312..>454 CDD:312941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.