DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and zgc:162872

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_009290262.1 Gene:zgc:162872 / 100004931 ZFINID:ZDB-GENE-081022-1 Length:701 Species:Danio rerio


Alignment Length:549 Identity:134/549 - (24%)
Similarity:206/549 - (37%) Gaps:198/549 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 PTTSRKSRRRSNLFIPSSSKKADKEKEPKSSEL------GSGRSIPI--------KQGYLYKRSS 465
            ||....:.:.|.|....|:|:.|.|    ::.|      .||.::.:        .||||:|||.
Zfish   215 PTMKTMASQLSQLSTDCSAKRKDLE----NTHLLVQQRDASGEAVIVCNPSDGGTIQGYLFKRSR 275

  Fly   466 KSLNKEWKKKY------------------VTLCDDGRLTYHPSLHDYMDDVHGKEIPLQYVTVKV 512
            |. ||.||:.:                  |.|.||.||....||     ||..:....:.::|: 
Zfish   276 KK-NKTWKRCWFSTENNQLIYLKSHKEQPVVLFDDLRLCAVKSL-----DVIDRRFCFELLSVQ- 333

  Fly   513 PGQKPRGSKSIITNSALTSSLMANGQRAQNTLSDGI-GCLTLAKDNQRKLSEKLSLLGAGSIAAG 576
                    |..:        |.|:.:..::...:.: ||:.:|..:|                  
Zfish   334 --------KCCV--------LQADSEELKSAWMNAVQGCIDMAYRDQ------------------ 364

  Fly   577 AGGEPLKSNSSQQTSGDEGIAMSNSNSQTFIAGEVANAGNKLEAQTPNVKKRHRRMKSSSVKANE 641
                                 :::.|:|                           :|.||..   
Zfish   365 ---------------------VTDQNTQ---------------------------VKESSAP--- 378

  Fly   642 ADDNDGYEFYIVSLDSKQWHFEAANSEERDEWVAAVEQEIFKSLQSIESSKTKQATSTDLAAMLA 706
                       ||:.....|..|                                    |...|:
Zfish   379 -----------VSIPDPPSHPPA------------------------------------LGVALS 396

  Fly   707 IRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVML 771
            .|    ||..|.|||...|.|||:|||:.|||||||:||:||.|:||||||.||.|....|.::.
Zfish   397 GR----GNQHCCDCGEAEPRWASVNLGITMCIECSGIHRSLGVHLSKVRSLTLDSWEPEQLKLLC 457

  Fly   772 AIGNSLANSVWESNTRQRV-KPTSQASREDKERWVRSKYEAKEFLTPLGNGSSAHP-SPSPGQQL 834
            .:||.:.|.::|......: ||::.:.|:|||:|:||||..|.|:....:|..|.. .....::|
Zfish   458 VLGNEVINGIYEREAADGLQKPSAGSPRQDKEQWIRSKYVEKRFVARHLDGPDADALKLRARKRL 522

  Fly   835 IEAVIRADIKSIVSILANCPSEVTNANVSARDVRTPLLLACAIGNLAIAQLLIWNGANIKHTD-- 897
            ..|.:..|:.::...||. .:|: |.|.:.::.||.|:.:...|:|...:.|:.||||:.|.|  
Zfish   523 YSASVSGDLVAMAESLAE-GAEI-NWNNNEQEGRTALIGSAIGGSLLACEFLLQNGANVNHRDQR 585

  Fly   898 ------------HEGRTCLAYARAAQSLA 914
                        |.|:.||...|.|...|
Zfish   586 GQGALHAAATYGHTGQVCLLLKRGANQYA 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 39/261 (15%)
PH 454..>521 CDD:278594 23/92 (25%)
ArfGap 702..818 CDD:279720 54/116 (47%)
ANK <834..907 CDD:238125 24/86 (28%)
ANK repeat 834..866 CDD:293786 8/31 (26%)
Ank_5 859..907 CDD:290568 18/61 (30%)
ANK repeat 868..897 CDD:293786 11/28 (39%)
zgc:162872XP_009290262.1 BAR_ACAPs 18..217 CDD:153287 1/1 (100%)
PH 265..357 CDD:278594 27/114 (24%)
PH_ACAP 266..362 CDD:270070 29/118 (25%)
ArfGap 399..504 CDD:279720 52/104 (50%)
Ank_2 <508..583 CDD:289560 21/76 (28%)
ANK 522..638 CDD:238125 27/95 (28%)
ANK repeat 552..583 CDD:293786 11/30 (37%)
Ank_2 557..649 CDD:289560 17/58 (29%)
ANK repeat 585..616 CDD:293786 7/30 (23%)
ANK repeat 618..649 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.