DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7968 and CG7916

DIOPT Version :9

Sequence 1:NP_609684.1 Gene:CG7968 / 34802 FlyBaseID:FBgn0028532 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_609682.1 Gene:CG7916 / 34800 FlyBaseID:FBgn0028534 Length:287 Species:Drosophila melanogaster


Alignment Length:269 Identity:70/269 - (26%)
Similarity:101/269 - (37%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRTSCVIFVALLCCSLGSAKLFDDELRELTE------------------------------FLRL 35
            |:....:||.||.|    ...:|.||  |||                              .|..
  Fly     1 MKAIVCVFVTLLAC----VAAYDVEL--LTEEQWDQLVARNPAKPDTQGLILNGSVKKAINGLLN 59

  Fly    36 QMRCGYPARGVPILAPAQMAYKEIGIRTENFGCNGNFTDLIIEGLDGYEFSKLEWNNILHT---- 96
            ||.||:|..|:|.|.|...|...|.:..........|.....:||:|.|..|::   :.:|    
  Fly    60 QMPCGWPQYGIPPLDPYTNADLRIHLAESVVDTLLQFLRFRFDGLEGMEIKKMK---VSYTFSKK 121

  Fly    97 IKFDMNFPKISLKS----TNYKLNLLARLFGADFSLWGDGALSLELINFRAYGSFVIRPKSATSG 157
            :||..|||::...:    ||..:|||..| |........|.||..|.|....|.|..:.......
  Fly   122 VKFHFNFPELKASAHYLDTNTFVNLLKEL-GLSVRYESSGPLSFSLQNLSIQGEFKYKMPFIFGS 185

  Fly   158 VYAKSWKVNWELEEAKSQTTGFMNSRLYTKFINDLIVEYLDIMINDNPTEVSQFMEELIVPPMNL 222
            :....:.....|....|...|.|.:....:||||::.:.:...||.|..::|..:||:.||..|.
  Fly   186 IKIYKFSCAVGLGGVSSNIGGVMGNGRINEFINDMLDKEIPAFINGNQEQISAKIEEIFVPLANA 250

  Fly   223 VL-DNLAWY 230
            .| .:..||
  Fly   251 HLTGHKIWY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7968NP_609684.1 JHBP 5..234 CDD:214779 69/265 (26%)
CG7916NP_609682.1 JHBP 33..262 CDD:214779 58/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D127466at33392
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20993
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.