DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7968 and CG8997

DIOPT Version :9

Sequence 1:NP_609684.1 Gene:CG7968 / 34802 FlyBaseID:FBgn0028532 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001285912.1 Gene:CG8997 / 34799 FlyBaseID:FBgn0028920 Length:260 Species:Drosophila melanogaster


Alignment Length:246 Identity:57/246 - (23%)
Similarity:118/246 - (47%) Gaps:11/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFVALL-------CCSLG---SAKLFDDELRELTEFLRLQMRCGYPARGVPILAPAQMAYKEIGI 61
            ||||:|       ..|:|   ..:.....:.::.|.::.||.||:.:.|:|.|||.::.:::|.|
  Fly     3 IFVAILAFVAVASAASMGQPIETQSISSTIVDVIEGIKEQMPCGFTSVGLPPLAPLRIDHQDINI 67

  Fly    62 RTENFGCNGNFTDLIIEGLDGYEFSKLEWNNILHTIKFDMNFPKISLKSTNYKLNLLARLFGADF 126
            .:......|......:.||:.::..:::.|.|...:.:...|..::: .|.|.|::|.:.:|...
  Fly    68 DSSVLKAQGTIDHFRLNGLNDFDIDEMKVNAITSKVTYKFTFRDVNV-DTQYDLSVLLKKYGFTI 131

  Fly   127 SLWGDGALSLELINFRAYGSFVIRPKSATSGVYAKSWKVNWELEEAKSQTTGFMNSRLYTKFIND 191
            :|.|.|.....:.:...:|:........:..:..||.:|...|.|..|:..|.:......:.:|:
  Fly   132 NLIGAGHAKFAIKDMVIWGTMKYSLGVISGNLKLKSLEVRTHLGEVDSEIEGILGDGSINEKMNE 196

  Fly   192 LIVEYLDIMINDNPTEVSQFMEELIVPPMNLVLDNLAWYEITAIILGLAEG 242
            .:.|.:::.||:|...::..:|.:.:|.:|.|||:::..||.:...|..||
  Fly   197 YLAEAVELAINENEDLIADTIESIALPAVNSVLDDISIAEIISGAGGDGEG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7968NP_609684.1 JHBP 5..234 CDD:214779 54/236 (23%)
CG8997NP_001285912.1 JHBP 21..239 CDD:214779 47/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D127466at33392
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20993
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.