DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7953 and CG7968

DIOPT Version :9

Sequence 1:NP_001285913.1 Gene:CG7953 / 34801 FlyBaseID:FBgn0028533 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_609684.1 Gene:CG7968 / 34802 FlyBaseID:FBgn0028532 Length:250 Species:Drosophila melanogaster


Alignment Length:228 Identity:62/228 - (27%)
Similarity:98/228 - (42%) Gaps:3/228 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 QARRFIRKLQKQMECGWPQYGIPVLAPLRINEFDLDYKKGIFETLNHVFRLKIAGLNDFNIQKFK 122
            :.|.....|:.||.||:|..|:|:|||.::...::..:...|....:...|.|.||:.:...|.:
  Fly    25 ELRELTEFLRLQMRCGYPARGVPILAPAQMAYKEIGIRTENFGCNGNFTDLIIEGLDGYEFSKLE 89

  Fly   123 LNVITSKITFDFLFKNIDTTAQKYDTDTLIDALRQLGLSVEYEGSGELLFDLVNLRIAGTLKYKL 187
            .|.|...|.||..|..|...:..|..:.|   .|..|......|.|.|..:|:|.|..|:...:.
  Fly    90 WNNILHTIKFDMNFPKISLKSTNYKLNLL---ARLFGADFSLWGDGALSLELINFRAYGSFVIRP 151

  Fly   188 PMLWGSAKITSLKTTISLESVTSDITGFMGNGKINRAINSQLENIVVKGINGNQDAISETIENAI 252
            ..........|.|....||...|..||||.:....:.||..:...:...||.|...:|:.:|..|
  Fly   152 KSATSGVYAKSWKVNWELEEAKSQTTGFMNSRLYTKFINDLIVEYLDIMINDNPTEVSQFMEELI 216

  Fly   253 VPRVNKMLKGKDFWTVVDLILASSDGESEDDPI 285
            ||.:|.:|....::.:..:||..::|....:||
  Fly   217 VPPMNLVLDNLAWYEITAIILGLAEGILPVEPI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7953NP_001285913.1 JHBP 44..268 CDD:214779 57/209 (27%)
CG7968NP_609684.1 JHBP 5..234 CDD:214779 57/211 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D127466at33392
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20993
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.