DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7953 and CG8997

DIOPT Version :9

Sequence 1:NP_001285913.1 Gene:CG7953 / 34801 FlyBaseID:FBgn0028533 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001285912.1 Gene:CG8997 / 34799 FlyBaseID:FBgn0028920 Length:260 Species:Drosophila melanogaster


Alignment Length:302 Identity:97/302 - (32%)
Similarity:158/302 - (52%) Gaps:48/302 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRFLVVLACLVAVCAAGTLPNEVEQRLLELADQNGDIDLVAEPQEGVEVAPQFIVSWQARRFIRK 65
            |:..|.:...|||.:|.::...:|.:.:    .:..:|::    ||:                  
  Fly     1 MKIFVAILAFVAVASAASMGQPIETQSI----SSTIVDVI----EGI------------------ 39

  Fly    66 LQKQMECGWPQYGIPVLAPLRINEFDLDYKKGIFE---TLNHVFRLKIAGLNDFNIQKFKLNVIT 127
             ::||.||:...|:|.||||||:..|::....:.:   |::| |||.  |||||:|.:.|:|.||
  Fly    40 -KEQMPCGFTSVGLPPLAPLRIDHQDINIDSSVLKAQGTIDH-FRLN--GLNDFDIDEMKVNAIT 100

  Fly   128 SKITFDFLFK--NIDTTAQKYDTDTLIDALRQLGLSVEYEGSGELLFDLVNLRIAGTLKYKLPML 190
            ||:|:.|.|:  |:||   :||...|   |::.|.::...|:|...|.:.::.|.||:||.|.::
  Fly   101 SKVTYKFTFRDVNVDT---QYDLSVL---LKKYGFTINLIGAGHAKFAIKDMVIWGTMKYSLGVI 159

  Fly   191 WGSAKITSLKTTISLESVTSDITGFMGNGKINRAINSQLENIVVKGINGNQDAISETIENAIVPR 255
            .|:.|:.||:....|..|.|:|.|.:|:|.||..:|..|...|...||.|:|.|::|||:..:|.
  Fly   160 SGNLKLKSLEVRTHLGEVDSEIEGILGDGSINEKMNEYLAEAVELAINENEDLIADTIESIALPA 224

  Fly   256 VNKMLKGKDFWTVVDLIL-ASSDGESEDDPIVVDCDPSADPW 296
            ||.:|   |..::.::|. |..|||..:...   |.|....|
  Fly   225 VNSVL---DDISIAEIISGAGGDGEGGEKEA---CIPPEFEW 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7953NP_001285913.1 JHBP 44..268 CDD:214779 81/228 (36%)
CG8997NP_001285912.1 JHBP 21..239 CDD:214779 83/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458087
Domainoid 1 1.000 84 1.000 Domainoid score I14929
eggNOG 1 0.900 - - E1_2CZNH
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I7353
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26067
OrthoDB 1 1.010 - - D127466at33392
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 1 1.000 - - otm49554
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20993
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.