DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7953 and CG33306

DIOPT Version :9

Sequence 1:NP_001285913.1 Gene:CG7953 / 34801 FlyBaseID:FBgn0028533 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_995706.1 Gene:CG33306 / 2768915 FlyBaseID:FBgn0053306 Length:244 Species:Drosophila melanogaster


Alignment Length:283 Identity:64/283 - (22%)
Similarity:114/283 - (40%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLVVLACLVAVCAAGTLPNEVEQRLLELADQNGDIDLVAEPQEGVEVAPQFIVSWQARRF----- 62
            ||:.|...:|.|                              :|.|||..  :|.|.|.|     
  Fly     5 FLIALIVALASC------------------------------QGAEVAEP--LSAQGRSFSSVIV 37

  Fly    63 --IRKLQKQMECGWPQYGIPVLAPLRINEFDLDYKKGIFETLNHVFRLKIAGLNDFNIQKFKLNV 125
              :...:..::.|.|::||||:||::..:...:...|.|.....|...::.||:.:.|....::|
  Fly    38 DGLEAFRVVLQNGSPRFGIPVMAPMKAAQRSFEINSGEFSGTFGVENFELQGLDQYEIITMNMDV 102

  Fly   126 ITSKITFDFLFKNIDTTAQKYDTDTLIDALRQLGLSVEYEGSGELLFDLVNLRIAGTLKYKLPML 190
            |.|::||:..|.:::.|.. |:.|        :|.....:.:|...|.|.:|.|.|.:.|.|.:.
  Fly   103 IRSRLTFNINFASLNFTTD-YEMD--------MGSGYRIKRNGGAFFALEDLNIQGRISYSLGVF 158

  Fly   191 WGSAKITSLKTTISLESVTSDITGFMGNGKINRAINSQLENIVVKGINGNQDAISETIENAIVPR 255
            ....::..:....|:.:|.|.|.........||.:|..:|..|...||.|.|.::..:.....|.
  Fly   159 TSQLRVKDVLIYPSVGNVNSQIENLSKYRIFNRKLNEIIEEFVTLTINENTDFVAAWVSEQATPI 223

  Fly   256 VNKMLKGKDFWTVVDLILASSDG 278
            .|.::..:   |:.|:|...:.|
  Fly   224 CNDLIGDR---TLSDIIAIITGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7953NP_001285913.1 JHBP 44..268 CDD:214779 55/230 (24%)
CG33306NP_995706.1 JHBP 16..230 CDD:299906 56/254 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458090
Domainoid 1 1.000 84 1.000 Domainoid score I14929
eggNOG 1 0.900 - - E1_2CZNH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D127466at33392
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20993
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.