DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8997 and CG33306

DIOPT Version :9

Sequence 1:NP_001285912.1 Gene:CG8997 / 34799 FlyBaseID:FBgn0028920 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_995706.1 Gene:CG33306 / 2768915 FlyBaseID:FBgn0053306 Length:244 Species:Drosophila melanogaster


Alignment Length:243 Identity:76/243 - (31%)
Similarity:129/243 - (53%) Gaps:9/243 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIFVAILAFVAVAS--AASMGQPIETQ--SISSTIVDVIEGIKEQMPCGFTSVGLPPLAPLRID 61
            ||....|...||:||  .|.:.:|:..|  |.||.|||.:|..:..:..|....|:|.:||::..
  Fly     1 MKSAFLIALIVALASCQGAEVAEPLSAQGRSFSSVIVDGLEAFRVVLQNGSPRFGIPVMAPMKAA 65

  Fly    62 HQDINIDSSVLKAQGTIDHFRLNGLNDFDIDEMKVNAITSKVTYKFTFRDVNVDTQYDLSVLLKK 126
            .:...|:|........:::|.|.||:.::|..|.::.|.|::|:...|..:|..|.|::.:    
  Fly    66 QRSFEINSGEFSGTFGVENFELQGLDQYEIITMNMDVIRSRLTFNINFASLNFTTDYEMDM---- 126

  Fly   127 YGFTINLIGAGHAKFAIKDMVIWGTMKYSLGVISGNLKLKSLEVRTHLGEVDSEIEGILGDGSIN 191
             |....:...|.|.||::|:.|.|.:.|||||.:..|::|.:.:...:|.|:|:||.:......|
  Fly   127 -GSGYRIKRNGGAFFALEDLNIQGRISYSLGVFTSQLRVKDVLIYPSVGNVNSQIENLSKYRIFN 190

  Fly   192 EKMNEYLAEAVELAINENEDLIADTIESIALPAVNSVLDDISIAEIIS 239
            .|:||.:.|.|.|.||||.|.:|..:...|.|..|.::.|.::::||:
  Fly   191 RKLNEIIEEFVTLTINENTDFVAAWVSEQATPICNDLIGDRTLSDIIA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8997NP_001285912.1 JHBP 21..239 CDD:214779 67/219 (31%)
CG33306NP_995706.1 JHBP 16..230 CDD:299906 66/218 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458092
Domainoid 1 1.000 84 1.000 Domainoid score I14929
eggNOG 1 0.900 - - E1_2CZNH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D127466at33392
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 1 1.000 - - mtm9712
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20993
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.