DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII33 and RPC40

DIOPT Version :9

Sequence 1:NP_477419.1 Gene:RpII33 / 34796 FlyBaseID:FBgn0026373 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_015435.1 Gene:RPC40 / 856226 SGDID:S000006314 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:303 Identity:85/303 - (28%)
Similarity:136/303 - (44%) Gaps:65/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VQITELTDDNVKFVLEDTELSVANSLRRVFIAETPTLAIDWVQLEANSTVLSDEFLAHRIGLIPL 73
            |.|:.|......|.|.:.:.|:||:.||:.|:|.|::|.::|....|::|:.||.|||||||:||
Yeast    42 VNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLVPL 106

  Fly    74 ISDDVVERLQYTRDCICLD--FCPECSVEFTLDVKCSEE--------------QTRHVTTADLKS 122
            ..|.  :.|.:....:..|  |..|.::..:|:|||:..              ...||...||| 
Yeast   107 KVDP--DMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNAHVYARDLK- 168

  Fly   123 SNAKVLPVTSRNQGEEDNEYGE-----SNDEILIIKLRKGQELKLRAYAKKGFGKEHAKWNPTAG 182
                     ...||.:...:.:     ::.:||:.|||.|||:.|:|:...|.|.:|||::|.:.
Yeast   169 ---------FEPQGRQSTTFADCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVST 224

  Fly   183 VCFEYDPDNSMRHTLYPKPDEWPK----------------SEHTELED-------------DQYE 218
            ..:...|..::   |.|...|..:                |:...::|             :::.
Yeast   225 ASYRLLPQINI---LQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFA 286

  Fly   219 APYNWEAKPNKFFFNVESAGALKPENIVVMGVQVLKNKLSNLQ 261
            .........|.|.||||||||:.||.|....|::||||...|:
Yeast   287 DKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNKAEYLK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII33NP_477419.1 RNAP_II_RPB3 7..267 CDD:132909 85/303 (28%)
RPOLD 19..261 CDD:214766 81/291 (28%)
RPC40NP_015435.1 RNAP_I_II_AC40 40..330 CDD:132910 85/303 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.