DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII33 and ATRPAC42

DIOPT Version :9

Sequence 1:NP_477419.1 Gene:RpII33 / 34796 FlyBaseID:FBgn0026373 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001320360.1 Gene:ATRPAC42 / 842377 AraportID:AT1G60850 Length:375 Species:Arabidopsis thaliana


Alignment Length:319 Identity:92/319 - (28%)
Similarity:137/319 - (42%) Gaps:97/319 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VQITELTDDNVKFVLEDTELSVANSLRRVFIAETPTLAIDWVQLEANSTVLSDEFLAHRIGLIPL 73
            |.:..||..:::|.:...:.:.||:.||:.|||.|::||:.|.:..|::|:.||.||||:||||:
plant    76 VDVVSLTKTDMEFDMIGIDAAFANAFRRILIAEVPSMAIEKVLIAYNTSVIIDEVLAHRMGLIPI 140

  Fly    74 ISDDVVERLQYTRDCICLDFCPE-------CSVEFTLDVKCSEEQTR-HVTTADLK-SSNAKVLP 129
            .:|   .||        .::..|       .::.|.|.|||.:.:.| .|.|:||| ..|...|.
plant   141 AAD---PRL--------FEYLSEHDQANEKNTIVFKLHVKCPKNRPRLKVLTSDLKWLPNGSELL 194

  Fly   130 VTSRNQGEEDNEYGE---SND---------------EILIIKLRKGQELKLRAYAKKGFGKEHAK 176
            ..|.|:..:...|..   |.|               :|||.||..|||::|.|:|.||.||.|||
plant   195 RESENKTSKPKTYTSFSCSQDSLPEFANNPITPCDLDILIAKLAPGQEIELEAHAVKGIGKTHAK 259

  Fly   177 WNPTAGVCFEYDPDNSMRHTLYPKPDEWPKSEHTELEDDQYE-----APYN-------------- 222
            |:|.....:...|:..:|               .|:||:..|     .|.|              
plant   260 WSPVGTAWYRMHPEVVLR---------------GEVEDELAERLVNVCPQNVFDIEDMGKGKKRA 309

  Fly   223 WEAKP-------------------------NKFFFNVESAGALKPENIVVMGVQVLKNK 256
            ..|:|                         |.|.||:||.|:|.||.:....|::|:.|
plant   310 TVAQPRKCTLCKECVRDDDLVDHVDLGSVKNHFIFNIESTGSLPPEVLFTEAVKILEAK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII33NP_477419.1 RNAP_II_RPB3 7..267 CDD:132909 92/319 (29%)
RPOLD 19..261 CDD:214766 89/309 (29%)
ATRPAC42NP_001320360.1 RNAP_I_II_AC40 74..375 CDD:132910 92/319 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D834009at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.