DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII33 and RPAC43

DIOPT Version :9

Sequence 1:NP_477419.1 Gene:RpII33 / 34796 FlyBaseID:FBgn0026373 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_176261.1 Gene:RPAC43 / 842356 AraportID:AT1G60620 Length:385 Species:Arabidopsis thaliana


Alignment Length:319 Identity:91/319 - (28%)
Similarity:144/319 - (45%) Gaps:78/319 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VQITELTDDNVKFVLEDTELSVANSLRRVFIAETPTLAIDWVQLEANSTVLSDEFLAHRIGLIPL 73
            |.:..||:.::.|.:......:||:.||:.:||.|::||:.|.:..|::|:.||.||||:||||:
plant    83 VDVISLTETDMVFDMIGVHAGIANAFRRILLAELPSMAIEKVYVANNTSVIQDEVLAHRLGLIPI 147

  Fly    74 ISDDVVERLQYTRDCICLDFCPE-------CSVEFTLDVKCSE-EQTRHVTTADLK--------- 121
            .:|   .||        .::..|       .::.|.|.|||.: :..|.|.|::||         
plant   148 AAD---PRL--------FEYLSENDQPNEKNTIVFKLHVKCLKGDPRRKVLTSELKWLPNGSELI 201

  Fly   122 --SSNAKVLP--VTSRNQGEE------DNEYGESNDEILIIKLRKGQELKLRAYAKKGFGKEHAK 176
              |..:...|  .||.|..::      :|....:..:|||.||..|||::|.|:|.||.||.|||
plant   202 KESGGSTTTPKTYTSFNHSQDSFPEFAENPIRPTLKDILIAKLGPGQEIELEAHAVKGIGKTHAK 266

  Fly   177 WNPTAGVCFEYDPDNSMRHTLYPKPDE-----WPKSEHTELED---------------------- 214
            |:|.|...:...|:..:......|..|     .||... ::||                      
plant   267 WSPVATAWYRMLPEVVLLKEFEGKHAEELVKVCPKKVF-DIEDMGQGRKRATVARPRDCSLCREC 330

  Fly   215 --DQYEAPYNWEAK------PNKFFFNVESAGALKPENIVVMGVQVLKNKLSNLQTQLS 265
              |..|    ||.:      .|.|.|.:||.|:..||.:....|::|::|...:.::||
plant   331 IRDGVE----WEDQVDLRRVKNHFIFTIESTGSQPPEVLFNEAVKILEDKCERVISELS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII33NP_477419.1 RNAP_II_RPB3 7..267 CDD:132909 91/319 (29%)
RPOLD 19..261 CDD:214766 86/303 (28%)
RPAC43NP_176261.1 RNAP_I_II_AC40 81..383 CDD:132910 89/315 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D834009at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.