DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII33 and XB5897337

DIOPT Version :9

Sequence 1:NP_477419.1 Gene:RpII33 / 34796 FlyBaseID:FBgn0026373 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001011496.1 Gene:XB5897337 / 496998 XenbaseID:XB-GENE-5897338 Length:297 Species:Xenopus tropicalis


Alignment Length:163 Identity:36/163 - (22%)
Similarity:63/163 - (38%) Gaps:35/163 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ANQPSV--------QITELTD----DNVK-FVLEDTELSVANSLRRVFIAETPTLAIDWVQLEAN 55
            ||.|.|        | ||.|.    |::: |.::||:         ||:...|.....|.| :..
 Frog     8 ANDPFVFKYRGVYFQ-TEYTTPQKIDSIQDFKVKDTD---------VFLVTYPKTGTIWTQ-QIL 61

  Fly    56 STVLSDEFLAHRIGLIPLISDDVVERLQYTRDCICLDFCPECSVEFTLDVKCSEEQTRHVTTADL 120
            |.:.::   .||.|...:.:...|..::||...:..|..|...:       .|.....::...||
 Frog    62 SLIFNE---GHRNGTEAIANVFRVPWIEYTHSKVDYDSRPSPRL-------FSSHLPHYLVPKDL 116

  Fly   121 KSSNAKVLPVTSRNQGEEDNEYGESNDEILIIK 153
            ::...|::.| .||..:....|....:.|:.:|
 Frog   117 RNKKGKIIYV-GRNPKDAAVSYYHFYNVIVRLK 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII33NP_477419.1 RNAP_II_RPB3 7..267 CDD:132909 34/160 (21%)
RPOLD 19..261 CDD:214766 27/136 (20%)
XB5897337NP_001011496.1 Sulfotransfer_1 41..286 CDD:395556 26/129 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165177130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.