powered by:
Protein Alignment RpII33 and CG4537
DIOPT Version :9
Sequence 1: | NP_477419.1 |
Gene: | RpII33 / 34796 |
FlyBaseID: | FBgn0026373 |
Length: | 275 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097135.1 |
Gene: | CG4537 / 34306 |
FlyBaseID: | FBgn0032153 |
Length: | 97 |
Species: | Drosophila melanogaster |
Alignment Length: | 32 |
Identity: | 6/32 - (18%) |
Similarity: | 15/32 - (46%) |
Gaps: | 3/32 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 FCPECSVEFTLDVKCSEEQTRHVTTADLKSSN 124
:|..|:.:..:...|.: :.:.|.:.|.|:
Fly 68 YCQACAYKKAICAMCGK---KIMNTKNYKQSS 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45469324 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.