DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tam and helq

DIOPT Version :9

Sequence 1:NP_476821.1 Gene:tam / 34792 FlyBaseID:FBgn0004406 Length:1145 Species:Drosophila melanogaster
Sequence 2:NP_001269352.1 Gene:helq / 562952 ZFINID:ZDB-GENE-060503-421 Length:1010 Species:Danio rerio


Alignment Length:295 Identity:57/295 - (19%)
Similarity:82/295 - (27%) Gaps:152/295 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 SSLNSLVE-----------VHRLYCGGD---------------TLSKEPRNIFVEGTLEQVR--Q 354
            |.:|||:|           |..|:..||               .:||..:.|.:..||..|:  |
Zfish   364 SLVNSLIENDRLDNIGLVVVDELHMLGDGSRGAILEMTLSKILYMSKSTQVIGMSATLGNVKDLQ 428

  Fly   355 SFQSLTNYCASDVEATHRILRVLYPLYAERFPHPASLAGMLEMGSAYLPVNSNWERYIREAQLTY 419
            ||....||.                                   :.:.||  ..:.|::.....|
Zfish   429 SFLRAENYT-----------------------------------NNFRPV--ELKEYVKIKDSIY 456

  Fly   420 EDLSIEAKYHLGRRAEEAC---SLLLDDQYRQNLWLWDEDWSV---------------------- 459
            |   ::.|       ||||   |.||:.:|...:...|.|..:                      
Zfish   457 E---VDPK-------EEACFTFSRLLNFKYSSGMQKMDPDHIIALATEVIPQQSCLIFCATKKNC 511

  Fly   460 ------------QELKLKQPPKRKPLPTVELKDSGN----------------------TPEERRL 490
                        :|. :|.....|.:...|||.|||                      |.:||:|
Zfish   512 ENLAGMICKYLNKEF-IKHKEAEKAILLGELKSSGNGSLCPVLQKTIPFGLAYHHSGLTSDERKL 575

  Fly   491 QAKFQHLYDQQAL--------------LPARRPLL 511
               .:..|....|              |||||.:|
Zfish   576 ---VEEAYSSGVLCLLTCTSTLAAGINLPARRVIL 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tamNP_476821.1 DNA_pol_A 398..>440 CDD:295402 10/44 (23%)
TRH <420..539 CDD:283171 33/165 (20%)
DNA_pol_gammaA 705..1107 CDD:176478
helqNP_001269352.1 BRR2 240..960 CDD:224125 57/295 (19%)
DEAD 266..427 CDD:278688 15/62 (24%)
HELICc 555..633 CDD:197757 12/56 (21%)
HHH_5 930..983 CDD:291205
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0749
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.