Sequence 1: | NP_476821.1 | Gene: | tam / 34792 | FlyBaseID: | FBgn0004406 | Length: | 1145 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001269352.1 | Gene: | helq / 562952 | ZFINID: | ZDB-GENE-060503-421 | Length: | 1010 | Species: | Danio rerio |
Alignment Length: | 295 | Identity: | 57/295 - (19%) |
---|---|---|---|
Similarity: | 82/295 - (27%) | Gaps: | 152/295 - (51%) |
- Green bases have known domain annotations that are detailed below.
Fly 318 SSLNSLVE-----------VHRLYCGGD---------------TLSKEPRNIFVEGTLEQVR--Q 354
Fly 355 SFQSLTNYCASDVEATHRILRVLYPLYAERFPHPASLAGMLEMGSAYLPVNSNWERYIREAQLTY 419
Fly 420 EDLSIEAKYHLGRRAEEAC---SLLLDDQYRQNLWLWDEDWSV---------------------- 459
Fly 460 ------------QELKLKQPPKRKPLPTVELKDSGN----------------------TPEERRL 490
Fly 491 QAKFQHLYDQQAL--------------LPARRPLL 511 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tam | NP_476821.1 | DNA_pol_A | 398..>440 | CDD:295402 | 10/44 (23%) |
TRH | <420..539 | CDD:283171 | 33/165 (20%) | ||
DNA_pol_gammaA | 705..1107 | CDD:176478 | |||
helq | NP_001269352.1 | BRR2 | 240..960 | CDD:224125 | 57/295 (19%) |
DEAD | 266..427 | CDD:278688 | 15/62 (24%) | ||
HELICc | 555..633 | CDD:197757 | 12/56 (21%) | ||
HHH_5 | 930..983 | CDD:291205 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0749 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |