DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tam and HELQ

DIOPT Version :9

Sequence 1:NP_476821.1 Gene:tam / 34792 FlyBaseID:FBgn0004406 Length:1145 Species:Drosophila melanogaster
Sequence 2:NP_598375.3 Gene:HELQ / 113510 HGNCID:18536 Length:1101 Species:Homo sapiens


Alignment Length:559 Identity:111/559 - (19%)
Similarity:187/559 - (33%) Gaps:165/559 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ENVENGPTEYAENLVKVQMISRNLHAQLFPQAPRSISEQ----QVASAKV--YKDELRRHGV-DI 99
            ||::|...:..::.:|.:....:.|..:..:.|.:..||    ..:|:||  ..|..||..: |.
Human   204 ENLQNSSNDLGDHSMKERDWKSSSHNTVNEELPHNCIEQPQQNDESSSKVRTSSDMNRRKSIKDH 268

  Fly   100 ESSAPVSDVQLKLP------ALRGANIEEHFHNIAKEQVQPYEELLLPLVQCEQLPKRPK----- 153
            ..:|...:.:.:.|      .|:...:.|.. |:||:.|:.....|.|..   .||.:.:     
Human   269 LKNAMTGNAKAQTPIFSRSKQLKDTLLSEEI-NVAKKTVESSSNDLGPFY---SLPSKVRDLYAQ 329

  Fly   154 --------RWAFHTGWTAYDPEDGTATPVDHPLEKGLVFDVEV-------CVSEGQAPVLATAVS 203
                    .|. ||..|....::........|...|.....|:       |..:....:|.....
Human   330 FKGIEKLYEWQ-HTCLTLNSVQERKNLIYSLPTSGGKTLVAEILMLQELLCCRKDVLMILPYVAI 393

  Fly   204 TKRWYSWVSS-------------------KLTKHRLSVEKLEPLDVDTDSERPHYTTDELIPLGT 249
            .:...|.:||                   ..||.|   || :.|.:.| .|:.|...:.||..|.
Human   394 VQEKISGLSSFGIELGFFVEEYAGSKGRFPPTKRR---EK-KSLYIAT-IEKGHSLVNSLIETGR 453

  Fly   250 TGP-GLVVGHNVSYDRARLKEQYLTEDTGTRFVDTMSLHMCVSGVTSYQRAMLKSK---KEPAAE 310
            ... ||||                        ||  .|||...|.......|..:|   .....:
Human   454 IDSLGLVV------------------------VD--ELHMIGEGSRGATLEMTLAKILYTSKTTQ 492

  Fly   311 DLGWLEQSSLNSLVEVHRLYCGGDTLSKEPRNI------FVEGTLEQV------RQSFQSLTNYC 363
            .:|.  .::||::.::.: :...:..:.:.|.:      .:..|:.:|      ..:|..|.||.
Human   493 IIGM--SATLNNVEDLQK-FLQAEYYTSQFRPVELKEYLKINDTIYEVDSKAENGMTFSRLLNYK 554

  Fly   364 ASD----VEATHRILRVLYPLYAERFPHPASLAGMLEMGSAYLPVNSNWERYIREAQLTYEDLSI 424
            .||    ::..|     |..|..|..|:.:.|        .:.|...|.|..   |::..:.|| 
Human   555 YSDTLKKMDPDH-----LVALVTEVIPNYSCL--------VFCPSKKNCENV---AEMICKFLS- 602

  Fly   425 EAKYHLGRRAEEACSLL--LDDQYRQNLWLWDEDWSVQELKLKQPPKRKPLP-TVELKDSGNTPE 486
              |.:|..:.:|.|.::  |.:....||.               |..::.:| .|....||.|.:
Human   603 --KEYLKHKEKEKCEVIKNLKNIGNGNLC---------------PVLKRTIPFGVAYHHSGLTSD 650

  Fly   487 ERRLQAKFQHLYDQQAL--------------LPARRPLL 511
            ||:|   .:..|....|              |||||.:|
Human   651 ERKL---LEEAYSTGVLCLFTCTSTLAAGVNLPARRVIL 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tamNP_476821.1 DNA_pol_A 398..>440 CDD:295402 10/41 (24%)
TRH <420..539 CDD:283171 26/109 (24%)
DNA_pol_gammaA 705..1107 CDD:176478
HELQNP_598375.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..261 9/48 (19%)
PRK02362 318..1066 CDD:235032 86/441 (20%)
DEXHc_POLQ-like 319..521 CDD:350784 41/236 (17%)
DEAH box 463..466 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0749
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.