DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment b and AT2G28230

DIOPT Version :10

Sequence 1:NP_476788.1 Gene:b / 34791 FlyBaseID:FBgn0000153 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_180390.2 Gene:AT2G28230 / 817369 AraportID:AT2G28230 Length:219 Species:Arabidopsis thaliana


Alignment Length:87 Identity:19/87 - (21%)
Similarity:32/87 - (36%) Gaps:28/87 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NNNITSTKDDLSSFVASHPAAEFEGF---------------------IRACVDEIIKLAVFQGTN 117
            :::|....:.|.|: .|..|..|:||                     :|..|.|:..|.: ....
plant    90 DSSIQLIMEKLQSY-KSKVALYFDGFQYQLGDFRLRVGKVVPTHSENVRGIVMEVEYLPI-SSME 152

  Fly   118 RSSKVVE-----WHEPAELRQL 134
            ::.||:|     |:|....|.|
plant   153 KAQKVMEEFLEIWNEALAKRSL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bNP_476788.1 GadA 127..573 CDD:439846 3/8 (38%)
AT2G28230NP_180390.2 Med20 1..208 CDD:400779 19/87 (22%)

Return to query results.
Submit another query.