DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment b and sepsecs

DIOPT Version :9

Sequence 1:NP_001246025.1 Gene:b / 34791 FlyBaseID:FBgn0000153 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_956448.1 Gene:sepsecs / 393123 ZFINID:ZDB-GENE-040426-859 Length:490 Species:Danio rerio


Alignment Length:90 Identity:20/90 - (22%)
Similarity:41/90 - (45%) Gaps:7/90 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 GFGSDHVRKIATNEVGKMRLSDLEKQVKLCLENGWQ-PLMVSATAGTTVLGAFDDLAGISEVCKK 347
            ||....:..:...:..:..|.::|::::   |.|.: .|.|.:|.........|.|..:|.:|.|
Zfish   183 GFEPVVIENVLEGDELRTNLEEVERKIE---EFGAENTLCVHSTTSCFAPRVPDRLEELSVLCAK 244

  Fly   348 YNMWMHVDAAWGGGALMSKKYRHLL 372
            :::...|:.|:|   :...|..||:
Zfish   245 HDIPHIVNNAYG---VQPSKCMHLI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bNP_001246025.1 AAT_I 128..499 CDD:302748 20/90 (22%)
sepsecsNP_956448.1 Tetramerization. /evidence=ECO:0000250|UniProtKB:Q9HD40 1..44
selenium_SpcS 12..458 CDD:211833 20/90 (22%)
Phosphate loop (P-loop). /evidence=ECO:0000250|UniProtKB:Q9HD40 96..106
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 466..490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.