DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment b and CG1486

DIOPT Version :9

Sequence 1:NP_001246025.1 Gene:b / 34791 FlyBaseID:FBgn0000153 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_608450.1 Gene:CG1486 / 33108 FlyBaseID:FBgn0031174 Length:852 Species:Drosophila melanogaster


Alignment Length:381 Identity:76/381 - (19%)
Similarity:134/381 - (35%) Gaps:109/381 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 AKPLIIFTSEDA-----HYSVEKLAMFMGFGSDHVRKIAT-NEVGKMRLSDLEKQVKLCLENGWQ 319
            |:| ..:.||:.     ||:..:|    |...:.::.|.. ::.|.|.::.|:||::..:.|...
  Fly   206 AQP-TFYISENTTPMRLHYACRQL----GIPLEAIKVIPEHSQSGTMDVTLLQKQIQQDVGNNRT 265

  Fly   320 PLMVSATAGTTVLGAFDDLAGISEVCKKYNMWMHVDAAWGGGALMSKKYRHLLNGIERADSVTWN 384
            ||:|.|..|.::.|..|:|..:.:|||.:|||:|.........:.::...|:   .|...|:..|
  Fly   266 PLLVVADIGASLCGYVDNLLRLRDVCKAHNMWLHASGHGLAALVCAQNQGHV---EEVLHSMALN 327

  Fly   385 PHKLLAASQQCSTFLTRHQQVLAQCHSTNATYLFQKDKFYDTSFDTGDKHIQCGRRADVFKFWFM 449
            ....|.........|.|..|       .:|...|:.|..             ..||.:....|..
  Fly   328 LGSWLGVPSLPIVLLHRPLQ-------NSALSAFESDPI-------------LSRRLNALSLWTS 372

  Fly   450 WKAKGTQGLEAHVEKVFRMAEF---FTAK------VRERPGFEL------VLESPECTNISFWYV 499
            .:|.|.:.:...:...|:....   ..:|      :...||.:.      |::||......|...
  Fly   373 LQALGRKAIAERLHVAFQTCSILFEIASKCEGIRVLSHTPGAQTGASLSDVIQSPFDVQALFDAA 437

  Fly   500 PP--------------------------------GLREMER--NREFYDRLHKVAPKVKEGMIKK 530
            .|                                ||:.:|:  |..::|||:....::.:     
  Fly   438 APVVAYQFDGSTTIPLGGSGSSAAAAAAERETAEGLKPLEKINNASYFDRLNSWLGQILQ----- 497

  Fly   531 GSMMITYQPLRQLPNFFRLVLQN----SCLEESDMVYFLDE-------IESLAQNL 575
                      |..|||...|:::    ||:....:...|.|       :||.||:|
  Fly   498 ----------RDCPNFDFEVIEHPTHGSCIRYCPLELGLGEQPPSSENLESFAQSL 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bNP_001246025.1 AAT_I 128..499 CDD:302748 54/258 (21%)
CG1486NP_608450.1 AAT_I 159..>384 CDD:302748 46/205 (22%)
WWbp <725..801 CDD:304964
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.