DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment b and HDC

DIOPT Version :9

Sequence 1:NP_001246025.1 Gene:b / 34791 FlyBaseID:FBgn0000153 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_016877583.1 Gene:HDC / 3067 HGNCID:4855 Length:697 Species:Homo sapiens


Alignment Length:538 Identity:132/538 - (24%)
Similarity:217/538 - (40%) Gaps:112/538 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RACVDEIIKLAVFQGTNRSSKVVEWHEPAELRQLFDFQLREQGESQDKL-----RELLRETIRFS 160
            |..||.|.:   :..|.|..:|....:|..||........|..:|.|.:     |.::...:.:.
Human    12 REMVDYICQ---YLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVVHWQ 73

  Fly   161 VKTGHPYFINQLYSGVDPY-ALVGQWLTDALNPSVYTYEVAPLFTLMEEQVLAEMRRIVGFPN-- 222
            ....|.|     |..:..: :|:|..|.||:|...:|:..:|..|.:|..|:..:.:::|.|.  
Human    74 SPHMHAY-----YPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPEHF 133

  Fly   223 -----GGQGDGIFCPGGSIANGYAISCARYRHSPESKKN------GLFNAKPLIIFTSEDAHYSV 276
                 ..||.|:.....|.:...|:..||.....|.|.:      ...||: |:.:.|:.||.||
Human   134 LHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESCLNAR-LVAYASDQAHSSV 197

  Fly   277 EKLAMF----MGFGSDHVRKIATNEVGKMRLSDLEKQVKLCLENGWQPLMVSATAGTTVLGAFDD 337
            ||..:.    |.|       :..::...:|...|:|.::...:.|..|:.|.||.|||.:.|||.
Human   198 EKAGLISLVKMKF-------LPVDDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAFDC 255

  Fly   338 LAGISEVCKKYN-----------------------------------MWMHVDAAWGGGALMSKK 367
            |:.:..:.|.::                                   :|:|:|||:.|.|.:..:
Human   256 LSELGPISKAHHPCSPPLSLARCETSFPTSYLPSGQVMFASSGAREGLWLHIDAAYAGTAFLCPE 320

  Fly   368 YRHLLNGIERADSVTWNPHKLLAASQQCSTFLTRHQQVLAQCHSTNATYLFQKDKFYDTSFDTGD 432
            :|..|.|||.|||.|:||.|.:.....|:.|..:.:..|.|..|.|..||...:....|.|    
Human   321 FRGFLKGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDF---- 381

  Fly   433 KH--IQCGRRADVFKFWFMWKAKGTQGLEAHVEKVFRMAEFFTAKVRERPGFELV---------- 485
            .|  |...||....|.||:.::.|.:.|:|||.....||::|.:.||..|.||:.          
Human   382 MHWQIPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVF 446

  Fly   486 -LESPEC--TNISFWYVPPGLREMERNREFYDRLHKVAPKVKEGMIKK---GSMMITYQPLRQLP 544
             |:.|.|  .|:        |:|:.:    ..||..:...:::.:|.:   .|...|...:.:..
Human   447 RLKGPNCLTENV--------LKEIAK----AGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDW 499

  Fly   545 NFFR----LVLQNSCLEE 558
            |..|    |:|...|..:
Human   500 NLIRDAATLILSQHCTSQ 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bNP_001246025.1 AAT_I 128..499 CDD:302748 113/443 (26%)
HDCXP_016877583.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.