DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment b and spl-1

DIOPT Version :9

Sequence 1:NP_001246025.1 Gene:b / 34791 FlyBaseID:FBgn0000153 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_499913.1 Gene:spl-1 / 176857 WormBaseID:WBGene00004981 Length:552 Species:Caenorhabditis elegans


Alignment Length:317 Identity:71/317 - (22%)
Similarity:121/317 - (38%) Gaps:97/317 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 IIKLAVFQGTNRSSKVVEWHEPAE---LRQL--FDFQL-------REQGE--------------- 144
            ::.||.|.||...:|||..:..:|   |:::  :.|.|       |::.|               
 Worm    33 VLVLAAFGGTLVYTKVVHLYRKSEDPILKRMGAYVFSLLRKLPAVRDKIEKELAAEKPKLIESIH 97

  Fly   145 -----------------SQDKLRELLR---ETIRFSVKTG----------HPYFINQLYSGVDPY 179
                             |||.:.||.:   :...|::..|          |...||.|....:.|
 Worm    98 KDDKDKQFISTLPIAPLSQDSIMELAKKYEDYNTFNIDGGRVSGAVYTDRHAEHINLLGKIYEKY 162

  Fly   180 ALVGQWLTDALNPSVYTYEVAPLFTLMEEQVLAEMRRIVGFPNGGQGDGIFCPGGSIANG----Y 240
            |     .::.|:|.|:     |....||.:::   |.::...||.:..     .||:.:|    .
 Worm   163 A-----FSNPLHPDVF-----PGARKMEAELI---RMVLNLYNGPEDS-----SGSVTSGGTESI 209

  Fly   241 AISCARYRHSPESKKNGLFNAKPLIIFTSEDAHYSVEKLAMFMGFGSDHVRKIATNEVGKMRLSD 305
            .::|..||:...|     ...:..:|...:.||.:.:|.|...|....||...:.|.|.   |.:
 Worm   210 IMACFSYRNRAHS-----LGIEHPVILACKTAHAAFDKAAHLCGMRLRHVPVDSDNRVD---LKE 266

  Fly   306 LEKQV--KLCLENGWQPLMVSATAGTTVLGAFDDLAGISEVCKKYNMWMHVDAAWGG 360
            :|:.:  .:|:..|..|...|        |..|.:..|:::.|||.:.:||||..||
 Worm   267 MERLIDSNVCMLVGSAPNFPS--------GTIDPIPEIAKLGKKYGIPVHVDACLGG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bNP_001246025.1 AAT_I 128..499 CDD:302748 63/296 (21%)
spl-1NP_499913.1 DOPA_deC_like 138..501 CDD:99743 50/212 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.