DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment b and basl-1

DIOPT Version :9

Sequence 1:NP_001246025.1 Gene:b / 34791 FlyBaseID:FBgn0000153 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_498210.1 Gene:basl-1 / 175779 WormBaseID:WBGene00015467 Length:509 Species:Caenorhabditis elegans


Alignment Length:419 Identity:88/419 - (21%)
Similarity:160/419 - (38%) Gaps:91/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 ESQDKL-RELLRETIRFSVKTGHPYFINQLYSGVDPYALVGQWLTDALNPSVYTYEVAPLFTLME 207
            ||.:|: .:|.:.....|....||:|.....:|:..::::...::..|....:|:...|..|.:|
 Worm    51 ESWEKVFGDLEKVIFNGSSHWNHPHFFAYFSAGIGYHSILADIISSGLGSVGFTWIACPPITELE 115

  Fly   208 EQVLAEMRRIVGFP------NGGQGDGIFCPGGSIANGYAISCAR-------------------- 246
            :..|..:..:...|      :.|.|.||.....|.:...||..||                    
 Worm   116 KITLDWLVDLTSLPVEFKNSHPGHGCGIIQSSASDSTLIAIMTARAAKVEFIKQNPSTFQWLINS 180

  Fly   247 ---------------------------YRHSPESKKNGLFNAKPLIIFTSEDAHYSVEKLAMFMG 284
                                       |.|.|...||       .:::.::.||.||||.||..|
 Worm   181 TSEHLRSISYWTPVNRTIHDSTDIITPYYHDPRVFKN-------FVMYFTDQAHSSVEKGAMLAG 238

  Fly   285 FGSDHVRKIATNEVGKMRLSDLEKQVKL-CLE----NGWQPLMVSATAGTTVLGAFDDLAGISEV 344
            .....:|.:.    |.|...:::.::.: .:|    .|:.|.||:.|.|||...|.||:..|.::
 Worm   239 VRFRKLRSVR----GYMENYEMDSKILIDAIEQDRSRGFIPFMVALTVGTTATCAADDVEKIGQI 299

  Fly   345 CKKYNMWMHVDAAWGGGALMSKKYRHLLNGIERADSVTWNPHKLLAASQQCSTFLTRHQQVLAQC 409
            |:|..:::|      |......::::|:||::..||...:.||....:..|.....::....::.
 Worm   300 CQKEGLYLH------GAFAFCDEFKYLVNGLKYVDSYNTDLHKAGMINFDCCPLWFKNGTYASRY 358

  Fly   410 HSTNATYLFQKDKFYDTSFDTGDKHIQCGRRADVFKFWFMWKAKGTQGLEAHVEKVFRMAEFFTA 474
            ::.:..||  ..::..::.|.....:..|||....|.||..:..|.:.:..:..|...:|..||.
 Worm   359 YNVDPVYL--AHEYQSSNMDYRHLEVPLGRRFRSLKVWFTMRNMGVEKIREYQRKTVSLALLFTK 421

  Fly   475 KVRERPGFELVLESPECTNISFWYVPPGL 503
            .:.|...|||             :.||.|
 Worm   422 IIVEGDKFEL-------------FTPPHL 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bNP_001246025.1 AAT_I 128..499 CDD:302748 85/413 (21%)
basl-1NP_498210.1 AAT_I 1..508 CDD:302748 88/419 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.