DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sos and YCL068C

DIOPT Version :9

Sequence 1:NP_476597.2 Gene:Sos / 34790 FlyBaseID:FBgn0001965 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_009865.2 Gene:YCL068C / 850291 SGDID:S000000573 Length:260 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:30/183 - (16%)
Similarity:72/183 - (39%) Gaps:41/183 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LKKVLEQ----------VHPRVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQDVEEKVNKSFPA 131
            |..:|||          :..::.::....:::..:...||....:..||::...|.:|:..|...
Yeast     9 LAYLLEQDDLFVTARFAIQGQIVSRRVNKIHISNITDVLLQQFISHTLPYNDNIVPKKILDSMRT 73

  Fly   132 PIDQWALNEAKEVINSK----KRKSVLPTEKVHTLLQKDVLQYKIDSSVSAFLVAV--------- 183
            .:.|  |.||...::.:    ||...:  ::....|..|..:...|:::.|.|:.|         
Yeast    74 AVRQ--LLEATACVSRECPLVKRSQDI--KRARKRLLSDWYRLGADANMDAVLLVVNSAWRFLAV 134

  Fly   184 -------LEYISADILKMAGDYVIKIAHCEITKEDI----EVVMNADRVLMDM 225
                   :::.:.::.:....|::   |..:..:.:    ::||..|.:|..|
Yeast   135 WRPFVNSIQHATQELYQNIAHYLL---HGNVNIQRVTALLQLVMGQDDLLFSM 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SosNP_476597.2 Histone 90..216 CDD:278551 21/149 (14%)
H2A 155..>196 CDD:305064 6/56 (11%)
RhoGEF 249..432 CDD:238091
PH_SOS 476..586 CDD:269963
PH 482..587 CDD:278594
RasGEFN 637..791 CDD:214571
RasGEF 825..1062 CDD:238087
YCL068CNP_009865.2 REM 196..>257 CDD:413353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.