DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sos and RALGPS2

DIOPT Version :9

Sequence 1:NP_476597.2 Gene:Sos / 34790 FlyBaseID:FBgn0001965 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_689876.2 Gene:RALGPS2 / 55103 HGNCID:30279 Length:583 Species:Homo sapiens


Alignment Length:514 Identity:107/514 - (20%)
Similarity:196/514 - (38%) Gaps:136/514 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   825 LLTLHPLELARQLTLLEFEMYKNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSIT 889
            :|.:.|.|.|.|:||::..::|.::|.||....|.||:|...:||.:...:...:|:.|:.:.|.
Human    45 VLKVTPEEYAGQITLMDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREIL 109

  Fly   890 EAENYEERLAIMQRAIEVMMVMLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECR 954
            .|:..:.|..::...|:....:.||||.:.::::|:.:.:|.::||..|:..|..:.:...|:..
Human   110 HAQTLKIRAEVLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLE 174

  Fly   955 EL--SDDHLKKYQERLRSIN-PPCVPFFGRYLTNILHLEEGNP---DLLANTELINFSKRRKVAE 1013
            .:  .:|:.|:.::.:.|:. .||:|:.|.||:::.:::...|   .:|.|.:..|.  ...:..
Human   175 YVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNL--MNNILR 237

  Fly  1014 IIGEIQQY---------QNQPYCLNEESTIRQFFEQLDPFNGLSDKQMSDYLYNESLRIEPRGCK 1069
            ||.::||.         ..|.| ||..    |:.|:|..|       :.|..|..||:|||    
Human   238 IISDLQQSCEYDIPMLPHVQKY-LNSV----QYIEELQKF-------VEDDNYKLSLKIEP---- 286

  Fly  1070 TVPKFPRKWPHIPLKSPGIKPRRQNQTNSSSKLSNSTSSVAAAAAASSTATSIATASAPSLHASS 1134
                                                           .|:|..:.||...|....
Human   287 -----------------------------------------------GTSTPRSAASREDLVGPE 304

  Fly  1135 IMDAPTAAAAN-AGSGTLAGEQSPQHN---PHAFSVFAPV---IIPERNTSSWSGT------PQH 1186
            :..:|.:...: |..|.|..:..|...   ||.......:   .|.:.||:.:...      |:|
Human   305 VGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGPRH 369

  Fly  1187 TRTDQNNGEVSVPAPHLPKKPGAHVWANNNSTLASASAMDVVFSPALPEHLPPQSLPDSNPFASD 1251
            ...|      ||..||.|.:..|     .:|||:|..::               ...|.:..:.:
Human   370 LLDD------SVMEPHAPSRGQA-----ESSTLSSGISI---------------GSSDGSELSEE 408

  Fly  1252 TEAPPSPLPKLVVSPRHETG-----NRSPFHGRMQNSPT--------HSTASTVTLTGM 1297
            |..|.....:|.    |..|     .|:.:...|:.|.:        |.....||:.|:
Human   409 TSWPAFERNRLY----HSLGPVTRVARNGYRSHMKASSSAESEDLAVHLYPGAVTIQGV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SosNP_476597.2 Histone 90..216 CDD:278551
H2A 155..>196 CDD:305064
RhoGEF 249..432 CDD:238091
PH_SOS 476..586 CDD:269963
PH 482..587 CDD:278594
RasGEFN 637..791 CDD:214571
RasGEF 825..1062 CDD:238087 62/251 (25%)
RALGPS2NP_689876.2 RasGEF 45..286 CDD:214539 64/254 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..314 9/81 (11%)
PXXP 324..327 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..406 12/59 (20%)
Required for stimulation of nucleotide exchange by RALA. /evidence=ECO:0000250 459..583 2/5 (40%)
PH_RalGPS1_2 459..574 CDD:270120 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.