DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sos and Rgl3

DIOPT Version :9

Sequence 1:NP_476597.2 Gene:Sos / 34790 FlyBaseID:FBgn0001965 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_001100275.1 Gene:Rgl3 / 300444 RGDID:1309756 Length:346 Species:Rattus norvegicus


Alignment Length:363 Identity:90/363 - (24%)
Similarity:144/363 - (39%) Gaps:99/363 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   706 GGMGGVGGDKEHKNSHREDWKRYRKEYVQPVQF-----RVLNVLRHWVDHHFYDFEKDPMLLEKL 765
            ||.......:....:.|.|.||...   |.:.|     .|::||..|:..|..||...|      
  Rat    10 GGSAASAQPQRGLETARVDSKRTEG---QDLNFSKNLRAVVSVLGSWLRDHPQDFRDPP------ 65

  Fly   766 LNFLEHVN--------------GKSMR---KWVDSVLKIVQRKNEQEKSNKKIVYAYGHDPPPIE 813
                :|.|              |..:|   |.::..||  :.|.||.:..:::.:|   .||   
  Rat    66 ----DHQNLGDVRIFLGWAAPGGAEVREAEKLLEDFLK--EAKEEQTEGEQRLAWA---GPP--- 118

  Fly   814 HHLSVPNDEIT---------------LLTLHPLELARQLTLLEFEMYKNVKPSELVGSPWTKKDK 863
            .....|..|..               ||.....|:|.||||::.|::..|:..|.:||.|:::|:
  Rat   119 WAAQSPRSEFAEDYSEEEGLRSEGPELLDFSVDEVAEQLTLMDVELFLRVRSCECLGSMWSQRDR 183

  Fly   864 EVK---SPNLLKIMKHTTNVTRWIEKSITEAENYEERLAIMQRA------IEVMMVMLELNNFNG 919
            ...   ||.:...:.....||..:..|:..|..    ||..|||      |.:.....||.||:.
  Rat   184 PGAAGISPTVRATVAQFNAVTGCVLGSVLAAPG----LAASQRAQRIEKWIRIAQRCRELRNFSS 244

  Fly   920 ILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECRELS------DDHLKK----YQER------- 967
            :.:|::|:.:..:|||:.::..:.   |:.|...|:||      |:||..    .||.       
  Rat   245 LRAILSALQSNPIYRLKRSWGAVS---REPLSVFRKLSQIFSDEDNHLSSRAILSQEETTEGPQG 306

  Fly   968 -------LRSINPP-CVPFFGRYLTNILHLEEGNPDLL 997
                   |.|..|| .||:.|.:||:::.|:...||:|
  Rat   307 DDCSPGSLPSKLPPGPVPYLGTFLTDLVMLDTALPDML 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SosNP_476597.2 Histone 90..216 CDD:278551
H2A 155..>196 CDD:305064
RhoGEF 249..432 CDD:238091
PH_SOS 476..586 CDD:269963
PH 482..587 CDD:278594
RasGEFN 637..791 CDD:214571 23/106 (22%)
RasGEF 825..1062 CDD:238087 59/207 (29%)
Rgl3NP_001100275.1 REM <36..100 CDD:295342 16/75 (21%)
RasGEF 152..345 CDD:279011 57/200 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.