DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sos and RGL4

DIOPT Version :9

Sequence 1:NP_476597.2 Gene:Sos / 34790 FlyBaseID:FBgn0001965 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_001316353.1 Gene:RGL4 / 266747 HGNCID:31911 Length:580 Species:Homo sapiens


Alignment Length:378 Identity:91/378 - (24%)
Similarity:154/378 - (40%) Gaps:89/378 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   804 AYGHDPPP---IEHH-------------LSVPNDEI-TLLTLHPLELARQLTLLEFEMYKNVKPS 851
            |.|..|||   :|..             .:.|::|: .:.|..|..||.||||::.|::|.|...
Human   177 APGEGPPPGTVLEPQSAPESSCPCRGSVKNQPSEELPDMTTFPPRLLAEQLTLMDAELFKKVVLH 241

  Fly   852 ELVGSPWTK---KDKEVKSPNLLKIMKHTTNVTRWIEKSI--TEAENYEERLAIMQRAIEVMMVM 911
            |.:|..|.:   |..|..:|.:...:.|...:|..|..|.  ..:....:|..:::..|:|....
Human   242 ECLGCIWGQGHLKGNEHMAPTVRATIAHFNRLTNCITTSCLGDHSMRARDRARVVEHWIKVAREC 306

  Fly   912 LELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEE-CRE------------------LS 957
            |.||||:.:..||:|:.:..:.:|..|:.|:..:..|.|:| |::                  ..
Human   307 LSLNNFSSVHVIVSALCSNPIGQLHKTWAGVSSKSMKELKELCKKDTAVKRDLLIKAGSFKVATQ 371

  Fly   958 DDHLKKYQERLRSINPPCVPFFGRYLTNILHLEEGNPDLLANTELINFSKRRKVAEIIGEIQ--Q 1020
            :.:.::.|.|||......|||.|.:||.:..|:...||.|..    |.:||.|...::.|:|  |
Human   372 ERNPQRVQMRLRRQKKGVVPFLGDFLTELQRLDSAIPDDLDG----NTNKRSKEVRVLQEMQLLQ 432

  Fly  1021 YQNQPYCLNEESTIRQFFEQLDPFNGLSDKQ------MSDYLYNE--------------SLRIE- 1064
            .....|.|........:|.:::.   ||||:      ||..:.|.              :|::: 
Human   433 VAAMNYRLRPLEKFVTYFTRMEQ---LSDKERWGFTMMSRIVSNSWPQAIHPPQPPKVLTLQLQA 494

  Fly  1065 --PRGCKTVPKFPRKWPH--IPLKSPGI----------KPRRQNQTNSSSKLS 1103
              |.|.:.    |..|.|  :....||.          .|.|::|..:|.:|:
Human   495 VLPAGARK----PVGWQHPAVAGNPPGCWPEHRLCTIPHPDRRHQGTTSRRLA 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SosNP_476597.2 Histone 90..216 CDD:278551
H2A 155..>196 CDD:305064
RhoGEF 249..432 CDD:238091
PH_SOS 476..586 CDD:269963
PH 482..587 CDD:278594
RasGEFN 637..791 CDD:214571
RasGEF 825..1062 CDD:238087 70/282 (25%)
RGL4NP_001316353.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..215 8/37 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.