DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sos and RASGEF1B

DIOPT Version :9

Sequence 1:NP_476597.2 Gene:Sos / 34790 FlyBaseID:FBgn0001965 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_689758.1 Gene:RASGEF1B / 153020 HGNCID:24881 Length:473 Species:Homo sapiens


Alignment Length:508 Identity:111/508 - (21%)
Similarity:185/508 - (36%) Gaps:111/508 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 MPSPEIYKFAVPDSGDNIVL---EERESAGVPMIKGATLCKLIERLTYHI------YADPTFVRT 666
            ||....:......||.|..|   .|....|:.......|...:|.|..|:      |.|.|::.|
Human     1 MPQTPPFSAMFDSSGYNRNLYQSAEDSCGGLYYHDNNLLSGSLEALIQHLVPNVDYYPDRTYIFT 65

  Fly   667 FLTTYRYFCSPQQLL----QLLVERFNIPDPSLVYQDTGTAGAGGMGGVGGDKEHKNSHREDWKR 727
            ||.:.|.|..|.:|:    .|.||...:.||.                     ..||..|:    
Human    66 FLLSSRLFMHPYELMAKVCHLCVEHQRLSDPD---------------------SDKNQMRK---- 105

  Fly   728 YRKEYVQPVQFRVLNVLRHWVDHHFYDFEKDPML--LEKLLNFLEHVNGKSMRKWVDSVLKIVQR 790
                 :.|   ::|.:|..|.:...|||..:.|:  |:.|.:.:.....::.||.|..:::.:.|
Human   106 -----IAP---KILQLLTEWTETFPYDFRDERMMRNLKDLAHRIASGEEQTYRKNVQQMMQCLIR 162

  Fly   791 K----NEQEKSNKKIVYAYGHDPPPIEHHLSVPNDEITLLTL--------------HPLELARQL 837
            |    ::.|:...||              .|...|.:|:|..              .|..||:||
Human   163 KLAALSQYEEVLAKI--------------SSTSTDRLTVLKTKPQSIQRDIITVCNDPYTLAQQL 213

  Fly   838 TLLEFEMYKNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIE----------KSITEAE 892
            |.:|.|....:.|.|.| ..:.:||......:.....|.|.|:..::|          ..|....
Human   214 THIELERLNYIGPEEFV-QAFVQKDPLDNDKSCYSERKKTRNLEAYVEWFNRLSYLVATEICMPV 277

  Fly   893 NYEERLAIMQRAIEVMMVMLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECRELS 957
            ..:.|..:::..|:|......:.|||.:::|::.|..:.|.||:.|:..:.......||...:.|
Human   278 KKKHRARMIEYFIDVARECFNIGNFNSLMAIISGMNMSPVSRLKKTWAKVKTAKFDILEHQMDPS 342

  Fly   958 DDHLKKYQERLR-----------SINPPCVPFFGRYLTNILHLEEGNPDLLANTELINFSKRRKV 1011
             .:...|:..||           |.....:|||...:.:|..|.||..:.|.|.. :||.|..::
Human   343 -SNFYNYRTALRGAAQRSLTAHSSREKIVIPFFSLLIKDIYFLNEGCANRLPNGH-VNFEKFWEL 405

  Fly  1012 AEIIGEIQQYQNQPYCLNEESTIRQFFEQLDPFNGLSDKQMSDYLYNESLRIE 1064
            |:.:.|...::........:..|.|:...:..|:       .|.||..|...|
Human   406 AKQVSEFMTWKQVECPFERDRKILQYLLTVPVFS-------EDALYLASYESE 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SosNP_476597.2 Histone 90..216 CDD:278551
H2A 155..>196 CDD:305064
RhoGEF 249..432 CDD:238091
PH_SOS 476..586 CDD:269963
PH 482..587 CDD:278594
RasGEFN 637..791 CDD:214571 36/165 (22%)
RasGEF 825..1062 CDD:238087 59/271 (22%)
RASGEF1BNP_689758.1 REM 42..167 CDD:100121 36/157 (23%)
RasGEF 209..403 CDD:395492 48/196 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.