DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sos and RASGRP2

DIOPT Version :9

Sequence 1:NP_476597.2 Gene:Sos / 34790 FlyBaseID:FBgn0001965 Length:1596 Species:Drosophila melanogaster
Sequence 2:XP_016872571.1 Gene:RASGRP2 / 10235 HGNCID:9879 Length:898 Species:Homo sapiens


Alignment Length:396 Identity:86/396 - (21%)
Similarity:169/396 - (42%) Gaps:59/396 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   725 WKRYRKEYVQPVQFRVLNVLRHWVDHHFYDFEKDPMLLEKLLNFLEHVNGKSMRKW-----VDSV 784
            :::.||:....:|.:..:::|:|:.....:|:.:|.|.|::......::.:..|:.     :|||
Human   348 YQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSV 412

  Fly   785 -----LKIVQRKNEQEKSNKKIVYAYGHDPPPIEHHLSVPNDEITLLTLHPLELARQLTLLEFEM 844
                 .:.|.::|...:..:|:...:.|                    |.|:|||..||.||:..
Human   413 PTYKWKRQVTQRNPVGQKKRKMSLLFDH--------------------LEPMELAEHLTYLEYRS 457

  Fly   845 YKNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSITEAENYEERLAIMQRAIEVMM 909
            :..:...:.  ..:......|.:|.|.:.:....:|::|::..|.......:|..::...:.|..
Human   458 FCKILFQDY--HSFVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAE 520

  Fly   910 VMLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECREL--SDDHLKKYQERLRSIN 972
            .:|:|.|||.::::|..:..:|:.||:.|...:.....|..|...||  :..:...|:.||.:  
Human   521 KLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAA-- 583

  Fly   973 PPCV----PFFGRYLTNILHLEEGNPDLL--ANTELINFSKRRKVAEIIGEIQQYQN-QPYCLNE 1030
              ||    |..|.:|.:::.|:...||.|  |.|.| |.:|.:::..|:.|:....: :|.....
Human   584 --CVGFRFPILGVHLKDLVALQLALPDWLDPARTRL-NGAKMKQLFSILEELAMVTSLRPPVQAN 645

  Fly  1031 ESTIRQFFEQLDPFNGLSDKQMSDYLYNESLRIEPRGCKTVPKFPRKWPHIPLKSPGIKPRRQNQ 1095
            ...:......||.:      |..|.||..||:.|||. |:.|..|...      :|..:|....:
Human   646 PDLLSLLTVSLDQY------QTEDELYQLSLQREPRS-KSSPTSPTSC------TPPPRPPVLEE 697

  Fly  1096 TNSSSK 1101
            ..|::|
Human   698 WTSAAK 703

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SosNP_476597.2 Histone 90..216 CDD:278551
H2A 155..>196 CDD:305064
RhoGEF 249..432 CDD:238091
PH_SOS 476..586 CDD:269963
PH 482..587 CDD:278594
RasGEFN 637..791 CDD:214571 14/75 (19%)
RasGEF 825..1062 CDD:238087 58/245 (24%)
RASGRP2XP_016872571.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.